SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|339444448|ref|YP_004710452.1| from Eggerthella sp. YY7918

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|339444448|ref|YP_004710452.1|
Domain Number - Region: 133-175
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.012
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|339444448|ref|YP_004710452.1|
Sequence length 232
Comment hypothetical protein EGYY_08580 [Eggerthella sp. YY7918]
Sequence
MAGAFDFKKEYRDLYMPKAKPTLIDVPPMTFIAVAGAGNPNEENGAYAEALGLLYGFSFT
VKMAKMGAWQPEGYFDYVVPPLEGLWWGGGFDGVRIMDKDALNWVSMIRQPDFVTPEVFA
WAAEQVAAKKPELDVSHARLVRFAEGSCAQVMHVGPYDDEPATIEVMEALIAASGHMDDI
ADPVSGDALLDALDADGAVPAVRLHHEIYLGDPRRTKPENLKTVIRHPVRSA
Download sequence
Identical sequences F7UZV8
WP_013979301.1.69488 gi|339444448|ref|YP_004710452.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]