SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|339444473|ref|YP_004710477.1| from Eggerthella sp. YY7918

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339444473|ref|YP_004710477.1|
Domain Number 1 Region: 21-87
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.52e-16
Family Arginine repressor (ArgR), N-terminal DNA-binding domain 0.0029
Further Details:      
 
Domain Number 2 Region: 93-157
Classification Level Classification E-value
Superfamily C-terminal domain of arginine repressor 0.0000000000000419
Family C-terminal domain of arginine repressor 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|339444473|ref|YP_004710477.1|
Sequence length 163
Comment hypothetical protein EGYY_08840 [Eggerthella sp. YY7918]
Sequence
MRKDRAEPYVIVLKGAESFESMRKRQQRHDVIRGIIREGNVKTQRDLANQLQAAGYECTQ
ATISRDIMDMGLVKSREGYYVLPEEMRLQRMVSELVEEVHVAGNMVVVKTFSGGAAGVSA
ALDKANLRGALGTVAGDNTIMIAAESPEAAVDVERAIDRLRRR
Download sequence
Identical sequences F7UZY3
gi|339444473|ref|YP_004710477.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]