SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|339444606|ref|YP_004710610.1| from Eggerthella sp. YY7918

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339444606|ref|YP_004710610.1|
Domain Number 1 Region: 8-164
Classification Level Classification E-value
Superfamily PEBP-like 1.57e-34
Family Prokaryotic PEBP-like proteins 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|339444606|ref|YP_004710610.1|
Sequence length 170
Comment phospholipid-binding protein [Eggerthella sp. YY7918]
Sequence
MHISVELENGLLPDRFGKYAPDSYQLDGHPIRSFPISISDVPEGTKSLALTFLDWDAIPV
CGFCWIHWIACNFPPDTTFIPEDASASEAIPCVQGSNSDWSSLAGDCTDPRVIHRYAGPY
PPDATHEYTLQVYALDCELDLEEGYYLNEFRHAIRGHVMAEATLELPSRA
Download sequence
Identical sequences F7V0B6
WP_013979459.1.69488 gi|339444606|ref|YP_004710610.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]