SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|339444629|ref|YP_004710633.1| from Eggerthella sp. YY7918

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339444629|ref|YP_004710633.1|
Domain Number 1 Region: 32-124
Classification Level Classification E-value
Superfamily Superoxide reductase-like 1.31e-30
Family Superoxide reductase-like 0.00047
Further Details:      
 
Domain Number 2 Region: 2-35
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.00000000122
Family Desulforedoxin 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|339444629|ref|YP_004710633.1|
Sequence length 126
Comment hypothetical protein EGYY_10540 [Eggerthella sp. YY7918]
Sequence
MELKFYKCAHCGSIAVKPFDSGVPLVCCGEPMTELVANTTDAAVEKHVPAVTVDGANVHV
QVGSTAHPMTPEHYITFICLQTKKGYQIAELSPEAEPVADFAVAAGDEPVRVYEYCNLHG
LWVAQL
Download sequence
Identical sequences F7V0D9
gi|339444629|ref|YP_004710633.1| WP_013979482.1.69488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]