SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|339444909|ref|YP_004710913.1| from Eggerthella sp. YY7918

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339444909|ref|YP_004710913.1|
Domain Number 1 Region: 9-174
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.58e-43
Family G proteins 0.0001
Further Details:      
 
Domain Number 2 Region: 181-272
Classification Level Classification E-value
Superfamily Translation proteins 1.92e-23
Family Elongation factors 0.00032
Further Details:      
 
Domain Number 3 Region: 270-368
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 1.01e-19
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0091
Further Details:      
 
Domain Number 4 Region: 588-642
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000347
Family C-terminal fragment of elongation factor SelB 0.0023
Further Details:      
 
Domain Number 5 Region: 450-516
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000177
Family C-terminal fragment of elongation factor SelB 0.018
Further Details:      
 
Weak hits

Sequence:  gi|339444909|ref|YP_004710913.1|
Domain Number - Region: 526-583
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000345
Family C-terminal fragment of elongation factor SelB 0.05
Further Details:      
 
Domain Number - Region: 395-435
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0471
Family ArsR-like transcriptional regulators 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|339444909|ref|YP_004710913.1|
Sequence length 644
Comment hypothetical protein EGYY_13600 [Eggerthella sp. YY7918]
Sequence
MGTDTVDLILGTAGHIDHGKSSLVQALTGVDPDRLVEEKKRGITIELGFARLDLPDGTSL
GVVDVPGHERFVRQMIAGSTGIDLALLCIAADDGIMPQTEEHLAVLDLLGVPSCVVALTK
IDLVDAEWAVFMADEIRSRLTTTPYADAPIVKVSSRTGEGLDELKVTLAEVAHTAQRSKT
GTTLRLPVDRSFSIKGAGTVVTGTLWSGTAAIGDEVEVLPSGLRTRIRSVQVHGEAVEYA
EAGHRVALNLNALSTDEVRPGDFLVAPNTLRPTDRFDADVRYLGIPGTTKPLVSGTRVHI
AHGTREVCGRVLFMNGKEDLKAGERAYAQIRLDEPLAVAWCDRFVLRSYSPVHVIGGGMV
LRAHPKRTTTLASETEALLDALAARDESRIARTAFALMPLPATVDELAEVSGLSADAAAH
ELKALEHERTAVRLQAPTANGRDRWVAKQQIQKHRSTIENELLKFHADYPDRTGIAKEAL
HQRCFPRATEECFDALIAEAAAAGVVAVSGGEVSHPQAGAGARVREEQAAAQLYSLLTQN
AGAPPTIEEVIATSGLDTKLAYRALGTLEREGKTVRVGQTFSFESAALSTFEQAVRTRLA
AGPATAAELRDALGTSRKYAIPLLEYFDACGITRREGDKRVLNE
Download sequence
Identical sequences F7V169
WP_013979762.1.69488 gi|339444909|ref|YP_004710913.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]