SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|339445268|ref|YP_004711272.1| from Eggerthella sp. YY7918

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339445268|ref|YP_004711272.1|
Domain Number 1 Region: 28-174
Classification Level Classification E-value
Superfamily RNase III domain-like 9.77e-38
Family RNase III catalytic domain-like 0.00054
Further Details:      
 
Domain Number 2 Region: 177-252
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.89e-20
Family Double-stranded RNA-binding domain (dsRBD) 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|339445268|ref|YP_004711272.1|
Sequence length 312
Comment dsRNA-specific ribonuclease [Eggerthella sp. YY7918]
Sequence
MSAQDEANVSPSGAHDPEFRKTLSDEQRRKLDRAQEILAYNFADERILLSAITHPSATEG
KSVKFSYERLEFLGDSILGAIVATIAFERFHDLDEGGLTRIKVALVSGASLSDVADGLGL
ADVIVFGSSETGTGRRGLHSALENVYEALTAALYLDSGIDAAVAFVKRTLIPRMSVGMAN
EPENPKSALQEKLQEDGITPTYKLVETQGPPHDRTFVAQVFAGTKGLARGTGRTKKEAES
QAAKSTLASLGKFFGLGMDEEERAEKAEAAKQAKAEKAEAVKQAKAEKAAARAEEKARKK
TERELAKQRKQG
Download sequence
Identical sequences F7UUJ8
gi|339445268|ref|YP_004711272.1| WP_013980115.1.69488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]