SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|339445946|ref|YP_004711950.1| from Eggerthella sp. YY7918

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339445946|ref|YP_004711950.1|
Domain Number 1 Region: 9-204
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 1.05e-51
Family Class I glutamine amidotransferases (GAT) 0.0000212
Further Details:      
 
Domain Number 2 Region: 188-434
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 7.28e-48
Family N-type ATP pyrophosphatases 0.0000108
Further Details:      
 
Domain Number 3 Region: 404-547
Classification Level Classification E-value
Superfamily GMP synthetase C-terminal dimerisation domain 1.03e-44
Family GMP synthetase C-terminal dimerisation domain 0.0000362
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|339445946|ref|YP_004711950.1|
Sequence length 547
Comment hypothetical protein EGYY_24800 [Eggerthella sp. YY7918]
Sequence
MTTAPASQLVIVVDFGAQYGQLIARRVRDLQVYSEIVPCDISADEVRAMAPAAIILSGGP
ASVYAEDAPSIDPEIFELGIPMLGFCYGQQIMAVTLGGTVGHTEVGEYGAAALHRCDEGT
SALYGETPVEQTVWMSHRDAVAEVPEGFVVTASTDVCPVASMECAERRLYATQFHPEVRH
TTCGDELLRNFLFGICGLKPTWEMDSIIDDAVKAIRAQVGSDRVILGLSGGVDSSVVAAL
CAKAIGKQLTCVFVNHGLLRKNEPEEVEAVFTKQFDVDFVHVHAEDRYAALLADVTEPEE
KRRIIGSQFWGEFFTVAQDLAEGGNPVKFLAQGTIYPDIIESGARKTGGKASTIKSHHNL
IPFPEGVSFDLIEPLDHFFKDEVRALGTALGLPDHIVHRQPFPGPGLAIRIIGTVTRDKL
AILKEADAIVREELDAYNVRMYEATGERDGELVRTTAGGPEVERPVWQYFAVLPDIKSVG
VMGDERTYGYPIILRAVESTDAMTADWAKLPYDVLGRISSRIVAEVPGVNRVAYDITSKP
PATVEWE
Download sequence
Identical sequences F7UWH6
WP_013980792.1.69488 gi|339445946|ref|YP_004711950.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]