SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|339445960|ref|YP_004711964.1| from Eggerthella sp. YY7918

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339445960|ref|YP_004711964.1|
Domain Number 1 Region: 6-69
Classification Level Classification E-value
Superfamily TTHA1013/TTHA0281-like 0.0000000017
Family TTHA0281-like 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|339445960|ref|YP_004711964.1|
Sequence length 133
Comment hypothetical protein EGYY_24940 [Eggerthella sp. YY7918]
Sequence
MRRTDRYFFPAVFTYESGREIAVEFPDLGVATSGVNDDDALLSARELLGCVLFGLEEDGE
DIPAPTPLSQVAIEPNEHTVLVDVYMPSVRQAQSTKAVNRTVTLPAWLNALAVEHDVNFS
QTLQSALRQQLKV
Download sequence
Identical sequences F7UWJ0
gi|339445960|ref|YP_004711964.1| WP_013980806.1.69488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]