SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336248068|ref|YP_004591778.1| from Enterobacter aerogenes KCTC 2190

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336248068|ref|YP_004591778.1|
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 5.93e-40
Family Frataxin-like 0.000000871
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|336248068|ref|YP_004591778.1|
Sequence length 106
Comment frataxin-like protein [Enterobacter aerogenes KCTC 2190]
Sequence
MNDSEFHRLADSLWMTIEERLDDWDGDSDIDCEINGGVLTISFENGSKIIINRQEPLHQV
WLATKQGGYHFDLQGDEWICDRSGERFWDLLEQAASNQAGETVSFR
Download sequence
Identical sequences A0A094X385 A0A0H3FUN2 A0A157VG18
2030388033 gi|444353820|ref|YP_007389964.1| 2030616485 gi|336248068|ref|YP_004591778.1| WP_015368867.1.101726 WP_015368867.1.101766 WP_015368867.1.10447 WP_015368867.1.10997 WP_015368867.1.11757 WP_015368867.1.11951 WP_015368867.1.12899 WP_015368867.1.14031 WP_015368867.1.14360 WP_015368867.1.1448 WP_015368867.1.14881 WP_015368867.1.16391 WP_015368867.1.18331 WP_015368867.1.20009 WP_015368867.1.20030 WP_015368867.1.20196 WP_015368867.1.21101 WP_015368867.1.21289 WP_015368867.1.22364 WP_015368867.1.23215 WP_015368867.1.23504 WP_015368867.1.24003 WP_015368867.1.24204 WP_015368867.1.24210 WP_015368867.1.26343 WP_015368867.1.28010 WP_015368867.1.28308 WP_015368867.1.28380 WP_015368867.1.31552 WP_015368867.1.31713 WP_015368867.1.32018 WP_015368867.1.32979 WP_015368867.1.33189 WP_015368867.1.33820 WP_015368867.1.3397 WP_015368867.1.34386 WP_015368867.1.35343 WP_015368867.1.35711 WP_015368867.1.3692 WP_015368867.1.37831 WP_015368867.1.38395 WP_015368867.1.39485 WP_015368867.1.39864 WP_015368867.1.41292 WP_015368867.1.41649 WP_015368867.1.41683 WP_015368867.1.42429 WP_015368867.1.45075 WP_015368867.1.45343 WP_015368867.1.45414 WP_015368867.1.45458 WP_015368867.1.46458 WP_015368867.1.48813 WP_015368867.1.49029 WP_015368867.1.49047 WP_015368867.1.49167 WP_015368867.1.49361 WP_015368867.1.49979 WP_015368867.1.51407 WP_015368867.1.56038 WP_015368867.1.56299 WP_015368867.1.56407 WP_015368867.1.56707 WP_015368867.1.56876 WP_015368867.1.57367 WP_015368867.1.57444 WP_015368867.1.58192 WP_015368867.1.58266 WP_015368867.1.60287 WP_015368867.1.62329 WP_015368867.1.62912 WP_015368867.1.64517 WP_015368867.1.64556 WP_015368867.1.65807 WP_015368867.1.67342 WP_015368867.1.67856 WP_015368867.1.68559 WP_015368867.1.68613 WP_015368867.1.68887 WP_015368867.1.69481 WP_015368867.1.70173 WP_015368867.1.70647 WP_015368867.1.7086 WP_015368867.1.71213 WP_015368867.1.72696 WP_015368867.1.73646 WP_015368867.1.74159 WP_015368867.1.74321 WP_015368867.1.74724 WP_015368867.1.77992 WP_015368867.1.78009 WP_015368867.1.7824 WP_015368867.1.78600 WP_015368867.1.78631 WP_015368867.1.79893 WP_015368867.1.79997 WP_015368867.1.80477 WP_015368867.1.80837 WP_015368867.1.82041 WP_015368867.1.822 WP_015368867.1.83454 WP_015368867.1.84824 WP_015368867.1.85165 WP_015368867.1.85538 WP_015368867.1.85838 WP_015368867.1.8842 WP_015368867.1.8881 WP_015368867.1.89270 WP_015368867.1.89701 WP_015368867.1.90534 WP_015368867.1.92042 WP_015368867.1.94443 WP_015368867.1.94861 WP_015368867.1.958 WP_015368867.1.95917 WP_015368867.1.96161 WP_015368867.1.99093 WP_015368867.1.99620 WP_015368867.1.99773 YP_004591778.1.85618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]