SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336249565|ref|YP_004593275.1| from Enterobacter aerogenes KCTC 2190

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336249565|ref|YP_004593275.1|
Domain Number 1 Region: 4-95
Classification Level Classification E-value
Superfamily YccV-like 1.44e-30
Family YccV-like 0.00000512
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|336249565|ref|YP_004593275.1|
Sequence length 105
Comment heat shock protein HspQ [Enterobacter aerogenes KCTC 2190]
Sequence
MIASKFGIGQQVRHTLLGYLGVIVDIDPEYSLDEPAADEIGANDELRAAPWYHVVMEDED
GQPVHTYLAEAQLSSEASDEHPEQPSMDELAQTIRKQLQAPRLRN
Download sequence
Identical sequences A0A094Y7H1 A0A0H3FQX3
WP_015367415.1.101726 WP_015367415.1.101766 WP_015367415.1.10447 WP_015367415.1.10997 WP_015367415.1.11757 WP_015367415.1.11951 WP_015367415.1.12899 WP_015367415.1.14031 WP_015367415.1.14360 WP_015367415.1.1448 WP_015367415.1.14881 WP_015367415.1.16391 WP_015367415.1.18331 WP_015367415.1.19394 WP_015367415.1.20009 WP_015367415.1.20030 WP_015367415.1.20196 WP_015367415.1.21101 WP_015367415.1.21289 WP_015367415.1.22364 WP_015367415.1.22858 WP_015367415.1.23215 WP_015367415.1.23504 WP_015367415.1.24003 WP_015367415.1.24204 WP_015367415.1.24210 WP_015367415.1.26343 WP_015367415.1.28010 WP_015367415.1.28308 WP_015367415.1.28380 WP_015367415.1.31552 WP_015367415.1.31713 WP_015367415.1.32018 WP_015367415.1.32979 WP_015367415.1.33189 WP_015367415.1.33820 WP_015367415.1.3397 WP_015367415.1.34053 WP_015367415.1.34386 WP_015367415.1.35343 WP_015367415.1.35711 WP_015367415.1.3692 WP_015367415.1.37831 WP_015367415.1.38395 WP_015367415.1.39485 WP_015367415.1.39864 WP_015367415.1.41292 WP_015367415.1.41649 WP_015367415.1.41683 WP_015367415.1.42429 WP_015367415.1.43459 WP_015367415.1.45075 WP_015367415.1.45343 WP_015367415.1.45414 WP_015367415.1.45458 WP_015367415.1.46458 WP_015367415.1.48813 WP_015367415.1.49029 WP_015367415.1.49047 WP_015367415.1.49167 WP_015367415.1.49361 WP_015367415.1.49979 WP_015367415.1.51407 WP_015367415.1.56038 WP_015367415.1.56299 WP_015367415.1.56407 WP_015367415.1.56707 WP_015367415.1.56751 WP_015367415.1.56876 WP_015367415.1.57367 WP_015367415.1.57444 WP_015367415.1.58192 WP_015367415.1.58266 WP_015367415.1.60287 WP_015367415.1.62086 WP_015367415.1.62329 WP_015367415.1.62912 WP_015367415.1.64517 WP_015367415.1.64556 WP_015367415.1.65807 WP_015367415.1.67342 WP_015367415.1.67856 WP_015367415.1.68559 WP_015367415.1.68613 WP_015367415.1.68887 WP_015367415.1.69481 WP_015367415.1.70173 WP_015367415.1.70647 WP_015367415.1.7086 WP_015367415.1.71213 WP_015367415.1.72696 WP_015367415.1.73646 WP_015367415.1.74159 WP_015367415.1.74321 WP_015367415.1.74724 WP_015367415.1.77992 WP_015367415.1.78009 WP_015367415.1.7824 WP_015367415.1.78600 WP_015367415.1.78631 WP_015367415.1.79893 WP_015367415.1.79997 WP_015367415.1.80477 WP_015367415.1.80837 WP_015367415.1.82041 WP_015367415.1.822 WP_015367415.1.83454 WP_015367415.1.84824 WP_015367415.1.85165 WP_015367415.1.85538 WP_015367415.1.85838 WP_015367415.1.8842 WP_015367415.1.8881 WP_015367415.1.89265 WP_015367415.1.89270 WP_015367415.1.89701 WP_015367415.1.90534 WP_015367415.1.92042 WP_015367415.1.94443 WP_015367415.1.958 WP_015367415.1.95917 WP_015367415.1.96161 WP_015367415.1.99093 WP_015367415.1.99620 WP_015367415.1.99773 YP_004593275.1.85618 gi|336249565|ref|YP_004593275.1| 2030487156 gi|444352270|ref|YP_007388414.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]