SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336246944|ref|YP_004590654.1| from Enterobacter aerogenes KCTC 2190

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336246944|ref|YP_004590654.1|
Domain Number 1 Region: 250-419
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 1.26e-58
Family Eukaryotic ODC-like 0.000000269
Further Details:      
 
Domain Number 2 Region: 25-277
Classification Level Classification E-value
Superfamily PLP-binding barrel 9.16e-58
Family Alanine racemase-like, N-terminal domain 0.00000000149
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|336246944|ref|YP_004590654.1|
Sequence length 420
Comment diaminopimelate decarboxylase [Enterobacter aerogenes KCTC 2190]
Sequence
MPRSLNATDTDLTADNLLRLPAEFGCPVWVYDAQIIRRQIAQLSQFDVVRFAQKACSNIH
ILRLMREQGVKVDSVSLGEIERALAAGYDPVQHPDDIVFTADLIDRATLERVKALQIPVN
AGSVDMLSQLGEVSPGHRVWLRVNPGFGHGHSQKTNTGGENSKHGIWFSQLPQALEVIRR
HSLQLVGIHMHIGSGVDYGHLEQVCGAMVRQVVEFGQDLQAISAGGGLSIPYHEGEEAID
TDHYFGLWNAAREQIAKHLGHPVKLEIEPGRFLVAESGVLVSQVRSVKEMGSRHFVLIDA
GFNDLMRPAMYGSYHHITALAADGRDLSGEPQLETVVAGPLCESGDVFTQQEGGKVETRL
LPAVAPGDYLVLHDTGAYGASMSSNYNSRPLLPEVLFDNGSARLIRRRQTIEELLALELI
Download sequence
Identical sequences A0A0G9QG44 A0A0H3FLT2 A0A157UD76
gi|336246944|ref|YP_004590654.1| WP_015369915.1.101726 WP_015369915.1.101766 WP_015369915.1.10447 WP_015369915.1.10997 WP_015369915.1.11757 WP_015369915.1.11951 WP_015369915.1.12899 WP_015369915.1.14031 WP_015369915.1.14360 WP_015369915.1.16391 WP_015369915.1.20196 WP_015369915.1.21101 WP_015369915.1.21289 WP_015369915.1.22364 WP_015369915.1.23215 WP_015369915.1.23504 WP_015369915.1.24003 WP_015369915.1.24204 WP_015369915.1.24210 WP_015369915.1.28010 WP_015369915.1.28308 WP_015369915.1.28380 WP_015369915.1.31552 WP_015369915.1.31713 WP_015369915.1.3397 WP_015369915.1.35711 WP_015369915.1.3692 WP_015369915.1.38395 WP_015369915.1.39485 WP_015369915.1.39864 WP_015369915.1.41292 WP_015369915.1.41649 WP_015369915.1.42429 WP_015369915.1.45075 WP_015369915.1.45343 WP_015369915.1.45458 WP_015369915.1.49029 WP_015369915.1.49167 WP_015369915.1.51407 WP_015369915.1.56038 WP_015369915.1.56299 WP_015369915.1.57444 WP_015369915.1.58192 WP_015369915.1.58266 WP_015369915.1.64517 WP_015369915.1.64556 WP_015369915.1.65807 WP_015369915.1.67342 WP_015369915.1.67856 WP_015369915.1.68559 WP_015369915.1.68613 WP_015369915.1.70173 WP_015369915.1.7086 WP_015369915.1.71213 WP_015369915.1.72696 WP_015369915.1.73646 WP_015369915.1.74159 WP_015369915.1.74724 WP_015369915.1.78009 WP_015369915.1.7824 WP_015369915.1.78631 WP_015369915.1.79997 WP_015369915.1.80477 WP_015369915.1.80837 WP_015369915.1.822 WP_015369915.1.83454 WP_015369915.1.85165 WP_015369915.1.85538 WP_015369915.1.85838 WP_015369915.1.8842 WP_015369915.1.89270 WP_015369915.1.89701 WP_015369915.1.90534 WP_015369915.1.92042 WP_015369915.1.94443 WP_015369915.1.94861 WP_015369915.1.958 WP_015369915.1.96161 WP_015369915.1.99093 WP_015369915.1.99620 WP_015369915.1.99773 YP_004590654.1.85618 gi|444354944|ref|YP_007391088.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]