SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336247120|ref|YP_004590830.1| from Enterobacter aerogenes KCTC 2190

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336247120|ref|YP_004590830.1|
Domain Number 1 Region: 92-369
Classification Level Classification E-value
Superfamily PLP-binding barrel 2.8e-67
Family Alanine racemase-like, N-terminal domain 0.001
Further Details:      
 
Domain Number 2 Region: 481-584
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 0.0000000767
Family Eukaryotic ODC-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|336247120|ref|YP_004590830.1|
Sequence length 658
Comment arginine decarboxylase [Enterobacter aerogenes KCTC 2190]
Sequence
MSDDMSLGSLSSAGEHGVLRSMQEVAMSSQEASKMLRTYNIAWWGNNYYDVNELGHISVC
PDPDVPEARVDLAELVKAREAQGQRLPALFCFPQILQHRLRSINAAFKRARESYGYNGDY
FLVYPIKVNQHRRVIESLIHSGEPLGLEAGSKAELMAVLAHAGMTRSVIVCNGYKDREYI
RLALVGEKMGHKVYLVIEKMSEIAIVLEEAARLNVVPRLGVRARLASQGSGKWQSSGGEK
SKFGLAATQVLQLVEILREAGHLESLQLLHFHLGSQMANIRDIATGVRESARFYVELHKL
GVNIQCFDVGGGLGVDYEGTRSQSDCSVNYGLNEYANNIIWAIGDACEENGLPHPTVITE
SGRAVTAHHTVLVSNIIGVERNEYTEATPPAKDAARPLQSMWETWLEMHETGNRRSLREW
LHDSQMDLHDIHIGYSSGTFNLQERAWAEQLYLNMCHEVQKQLDPSNRAHRPIIDELQER
MADKIYVNFSLFQSMPDAWGIDQLFPVMPLEGLNKSPERRAVLLDITCDSDGAIDHYVDG
DGIATTMPMPEYDPENPPMLGFFMVGAYQEILGNMHNLFGDTEAVDVFVFPDGSVEVELS
DEGDTVADMLQYVQLDPNTLLTQFRDQVKNTGLDAELQQQFLEEFEAGLYGYTYLEDE
Download sequence
Identical sequences A0A0H3FJQ3
WP_015703451.1.39864 YP_004590830.1.85618 gi|336247120|ref|YP_004590830.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]