SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336248188|ref|YP_004591898.1| from Enterobacter aerogenes KCTC 2190

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336248188|ref|YP_004591898.1|
Domain Number 1 Region: 8-235
Classification Level Classification E-value
Superfamily PLP-binding barrel 2.47e-69
Family Alanine racemase-like, N-terminal domain 0.0000019
Further Details:      
 
Domain Number 2 Region: 228-358
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 4.88e-43
Family Alanine racemase 0.0000683
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|336248188|ref|YP_004591898.1|
Sequence length 359
Comment alanine racemase [Enterobacter aerogenes KCTC 2190]
Sequence
MQAATVVINRRALRHNLQRLRELAPASKLVAVVKANAYGHGLLETARTLTDADAFGVARL
EEALRLREGGITQPILLLEGFFEAADLALISAQRLHTVVHSPEQLAALEQAELAEPVTVW
MKLDTGMHRLGVLPEQAEAFYQRLSRCKNVRQPVNIVSHFARADEPECGATERQLDIFTT
FTEGKPGLRSIAASGGILLWPQSHFDWARPGIILYGVSPLENHSTGEDFGCLPVMSLTSS
LIAVREHKAGEPVGYGGTWISERDTRLGVVAMGYGDGYPRAAPSGTPVLVNGREVPIVGR
VAMDMICVDLGPQAQDQAGDPVVLWGEGLPVERIAEITKVSAYELITRLTSRLAIRYLD
Download sequence
Identical sequences A0A0H3FUZ4
WP_015704045.1.1448 WP_015704045.1.20009 WP_015704045.1.24003 WP_015704045.1.26343 WP_015704045.1.28308 WP_015704045.1.31552 WP_015704045.1.33820 WP_015704045.1.3397 WP_015704045.1.35711 WP_015704045.1.39485 WP_015704045.1.39864 WP_015704045.1.45414 WP_015704045.1.45458 WP_015704045.1.49979 WP_015704045.1.56707 WP_015704045.1.58266 WP_015704045.1.64517 WP_015704045.1.67856 WP_015704045.1.68613 WP_015704045.1.78600 WP_015704045.1.79893 WP_015704045.1.79997 WP_015704045.1.80837 WP_015704045.1.89701 WP_015704045.1.95917 YP_004591898.1.85618 gi|336248188|ref|YP_004591898.1| 2035947299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]