SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336248568|ref|YP_004592278.1| from Enterobacter aerogenes KCTC 2190

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336248568|ref|YP_004592278.1|
Domain Number 1 Region: 36-272
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.81e-33
Family Alanine racemase-like, N-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|336248568|ref|YP_004592278.1|
Sequence length 406
Comment hypothetical protein EAE_10415 [Enterobacter aerogenes KCTC 2190]
Sequence
MKYHSAPLIPHKSALMSAPANLLAEEVCLPAALLKKSALENNISWMQRYADARGVSLAPH
GKTTMTPWIFQAQQRAGAWGIGVGSAWQASAAMASGIQRVLMVNQLVGKANMQVVAQLKA
HYRAVDFICCVDSEANVRTLSAFFTAQGQTLDVLIELGVPGGRCGCRSVDDALALAQRVS
DLPGLRLRGLELYEGVLHGDDPQPQVEALLQQAAALACRMESLVDGEFILTGAGTVWYDV
VCNIWLAAAKPRRCRIVIRPGCYITHDRGIYDLAQQELIARDPIACDLAGDLTSALELMA
MVQSVPEADRAVVNFGKRDCAFDAGLPQPITHYRNGQQLALRAESIVSIGIMDQHCMLRL
APGSDVQVGDILLFGTSHPCLTFDKWKTLLLVDDDYNVLDELDTLF
Download sequence
Identical sequences A0A0H3FNJ4
WP_015704303.1.28308 WP_015704303.1.39485 WP_015704303.1.39864 WP_015704303.1.85838 YP_004592278.1.85618 gi|336248568|ref|YP_004592278.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]