SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336250887|ref|YP_004594597.1| from Enterobacter aerogenes KCTC 2190

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336250887|ref|YP_004594597.1|
Domain Number 1 Region: 9-233
Classification Level Classification E-value
Superfamily PLP-binding barrel 8.01e-67
Family Alanine racemase-like, N-terminal domain 0.00000351
Further Details:      
 
Domain Number 2 Region: 227-355
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 5.58e-45
Family Alanine racemase 0.0000202
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|336250887|ref|YP_004594597.1|
Sequence length 356
Comment alanine racemase [Enterobacter aerogenes KCTC 2190]
Sequence
MSRPVKASIDLSALRQNLQIVRRAAPGARVWAVVKANAYGHGLARMWQALNAADGYALLN
LEEAILLREKGWKGPILLLEGFFHADELALLDKYRLTTSVHSNWQIKALQQAKLHAPLDI
YLKVNSGMNRLGFMPERVHTVWQQLRSLANVGEMTLMSHFADAENPEGIAEPMRRIEQAA
EGLDCPRSLSNSAATLWHPEAHFDWVRPGIVLYGASPSGQWRDIANSGLKPAMTLSSEVI
AVQTLKSGERVGYGGLYQTSGEQRIGIVACGYADGYPRVAPSGTPVLVDGVRTTTVGRVS
MDMLAVDLTPCPHAGIGAPVELWGQEIKIDDVAAASGTVGYELMCALAPRVPVVTV
Download sequence
Identical sequences A0A0H3FU78
gi|336250887|ref|YP_004594597.1| WP_015705840.1.14031 WP_015705840.1.1448 WP_015705840.1.19394 WP_015705840.1.20009 WP_015705840.1.20030 WP_015705840.1.31552 WP_015705840.1.3397 WP_015705840.1.39864 WP_015705840.1.41649 WP_015705840.1.45458 WP_015705840.1.49979 WP_015705840.1.56707 WP_015705840.1.62086 WP_015705840.1.67856 WP_015705840.1.68613 WP_015705840.1.71213 WP_015705840.1.78600 WP_015705840.1.822 WP_015705840.1.95917 YP_004594597.1.85618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]