SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|345300901|ref|YP_004830259.1| from Enterobacter asburiae LF7a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|345300901|ref|YP_004830259.1|
Domain Number 1 Region: 3-363
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 4.23e-108
Family FMN-linked oxidoreductases 0.0000000000437
Further Details:      
 
Domain Number 2 Region: 334-519
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 5.41e-40
Family N-terminal domain of adrenodoxin reductase-like 0.00000123
Further Details:      
 
Domain Number 3 Region: 469-628
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.26e-23
Family C-terminal domain of adrenodoxin reductase-like 0.00000023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|345300901|ref|YP_004830259.1|
Sequence length 673
Comment NADH:flavin oxidoreductase [Enterobacter asburiae LF7a]
Sequence
MSRYPSLFAPLDLGFTTLKNRVLMGSMHTGLEEHPDGAERLAAFYAERARHGVALIVTGG
VAPAPSGVGMEGGAVLNDASQLPHHRIVTDAVHKEGGKIALQILHTGRYSYQPKLVAPSA
IQAPINRFKPHALGHDEILTLIDDFARCAALAREAGYDGVEVMGSEGYLINEFLAARTNQ
RDDEWGGDYARRMRFAIEVVRAVRERAGADFIIVFRLSMLDLVEGGGTFDETVQLAQAIE
TAGATIINTGIGWHEARIPTIATPVPRAAFSWVTRKLKGKVSIPLVTTNRINDPQVADDV
ISRGDADMVSMARPFLADAELLSKAQSGRADEINTCIGCNQACLDQIFVGKVTSCLVNPR
ACHETKMPVIPTSNKKRLAVVGAGPAGLAFAVNAASRGHSVTLFDAASEIGGQFNIAKQI
PGKEEFYETLRYYRRMIALTGVDLRLNQFVNAADLADFDEVILASGIAPRLPAIEGIDHP
KVLSYLDVLRDKTPVGESVAIIGCGGIGFDTAMYLSQPGEATSQNIAEFCVEWGIDTSLN
QAGGLRPEGPQLPKSPRQIVMLQRKASKPGEGLGKTTGWIHRATLLSRGVKMIPAVSYQK
IDDEGLHVLIGGEPQLLRVDNIILCAGQEPKRDLADPLREAGKTVHLIGGCDVAMELDAR
RAIAQGTKLALAI
Download sequence
Identical sequences A0A198GZC4 G2SC98
WP_014071833.1.75813 WP_014071833.1.95910 WP_014071833.1.96315 gi|345300901|ref|YP_004830259.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]