SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568186110|ref|YP_008958635.1| from Pseudomonas monteilii SB3101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568186110|ref|YP_008958635.1|
Domain Number 1 Region: 5-314
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.76e-100
Family Biotin dependent carboxylase carboxyltransferase domain 0.00000000364
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568186110|ref|YP_008958635.1|
Sequence length 315
Comment acetyl-CoA carboxylase subunit alpha [Pseudomonas monteilii SB3101]
Sequence
MNPNFLDFEQPIADLQAKIEGLRLVGNDNSLNISDEIARLQDKSNTLTESIFGNLTSWQI
ARLARHPRRPYTLDYLEHIFTEFEELHGDRHFSDDAAIVGGTARLDGKPVMVIGHQKGRE
VREKVRRNFGMPRPEGYRKACRLMEMAERFKMPILTFIDTPGAYPGIDAEERNQSEAIAW
NLRVMARLKTPIIATVIGEGGSGGALAIGVCDQLNMLQYSTYSVISPEGCASILWKTADK
AADAAEAMGITAERLKSLNIVDKVIQEPLGGAHRDPAKMSESIRADLVQQLDMLGKLDHD
ALLARRYDRLMSYGI
Download sequence
Identical sequences A0A059UT13 A0A099MWK7 A0A0C1I1N8 F8G012 V9UW19
WP_013971263.1.15314 WP_013971263.1.1643 WP_013971263.1.23948 WP_013971263.1.28354 WP_013971263.1.33515 WP_013971263.1.35335 WP_013971263.1.56258 WP_013971263.1.65739 WP_013971263.1.7288 WP_013971263.1.7435 WP_013971263.1.78427 WP_013971263.1.80759 WP_013971263.1.95946 2035932059 gi|568180679|ref|YP_008953206.1| gi|568186110|ref|YP_008958635.1| gi|339486129|ref|YP_004700657.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]