SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568186214|ref|YP_008958740.1| from Pseudomonas monteilii SB3101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568186214|ref|YP_008958740.1|
Domain Number 1 Region: 185-277,370-555
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.49e-69
Family Tail specific protease, catalytic domain 0.0000707
Further Details:      
 
Domain Number 2 Region: 258-332
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000241
Family PDZ domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568186214|ref|YP_008958740.1|
Sequence length 704
Comment peptidase S41 [Pseudomonas monteilii SB3101]
Sequence
MRDQLSPRRISMKHFLPSTALALMIGLGSLTLGGNAAAANKWDSLQPDRDEIVASLNVVE
LLKRHHYSKPPLDDARSVIIYDSYIKLLDPARSYFTAADIAEFDKWKTQFDDFLKSGNLD
PGFTIYKRYLDRVKQRLDFALAELNKGVDKIDFNAKETLLIDRKDAPWMKDQAELDDLWR
KRVKDEVLRQKIAGKEPKQIQETLTKRYKNQLSRLDQTRAEDIFQAYINTFAQSYDPHTN
YLSPDNAENFDINMSLSLEGIGAVLQSDNDQVKIVRLVPAGPAAKTKQVAPADKIIGVAQ
GNKEMVDVVGWRLDEVVKLIRGPKGSVVRLEIIPASNAPSDQTSKIVSITREAVKLEEQA
AKKSVLKLKQDGRDYKLGIIEIPAFYLDFKAYRAGDPEYKSTTRDVKKLLTELQKEKVDG
VVIDLRNNGGGSLQEATELTSLFIEKGPTVLVRNSDGRVDVLEDENPGAFYKGPLALLVN
RLSASASEIFAGAMQDYHRALIIGGQTFGKGTVQTIQPLNHGELKLTLAKFYRVSGQSTQ
HQGVLPDIDYPSIIDTKEIGESALPEAMPWDTIRPVVKPAADPFKPFLAQLKAQHEARSD
KDAEFTYIRDRLALTQKLMNEKTVSLNEQDRRARHDAIEAKQLALENIRRKAKGEEPLKE
LKKEDEDALPTEDENTKPEDDAYLSETGRILIDYLSASTKVAKK
Download sequence
Identical sequences A0A0C1KBP6 A0A0P7CXY1 A0A136QLJ0 A0A2A3M8C7 V9UVQ1
gi|568186214|ref|YP_008958740.1| WP_024086427.1.1643 WP_024086427.1.23948 WP_024086427.1.28354 WP_024086427.1.35335 WP_024086427.1.56258 WP_024086427.1.57632 WP_024086427.1.65739 WP_024086427.1.71677 WP_024086427.1.7288 WP_024086427.1.7435 WP_024086427.1.95946 gi|568180783|ref|YP_008953311.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]