SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568186338|ref|YP_008958868.1| from Pseudomonas monteilii SB3101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568186338|ref|YP_008958868.1|
Domain Number 1 Region: 3-226
Classification Level Classification E-value
Superfamily ClpP/crotonase 7.47e-45
Family Crotonase-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568186338|ref|YP_008958868.1|
Sequence length 229
Comment enoyl-CoA hydratase [Pseudomonas monteilii SB3101]
Sequence
MSELITYHAEDGIVTLTLNNGKVNAISPDVIAAFNAALDRATEERAVVIITGQPGILSGG
YDLKVMTSGPKEAISLVTAGSTLARRLLSHPFPVVVACPGNAVAKGAFLLLSGDYRIGVE
GPYKVCLNEVQIGMTMHHAGIELARDRLRRSAFHRSVINAEVFDPQGAVDAGFLDKVVPA
EQLQDAALEKARELKKLNMLAHKHTKLKVRKELLEALDKAIELDQHYTG
Download sequence
Identical sequences A0A059UTG6 A0A0C1KLM2 A0A2A3M7N5 F8G4L3 V9UZ39
gi|568186338|ref|YP_008958868.1| gi|339486413|ref|YP_004700941.1| WP_013971521.1.1643 WP_013971521.1.23948 WP_013971521.1.28354 WP_013971521.1.35335 WP_013971521.1.56258 WP_013971521.1.65739 WP_013971521.1.7435 2036022559 gi|568180907|ref|YP_008953439.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]