SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568186553|ref|YP_008959088.1| from Pseudomonas monteilii SB3101

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|568186553|ref|YP_008959088.1|
Domain Number - Region: 12-76
Classification Level Classification E-value
Superfamily ClpP/crotonase 0.0104
Family Crotonase-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568186553|ref|YP_008959088.1|
Sequence length 171
Comment PasA protein [Pseudomonas monteilii SB3101]
Sequence
MAQELYTRTNQKLFFAGLALESMAKAEQSQAMNAQGLVQAERESALFHLYGALLGLCHEI
GGFYRLPVVATVEQALADDALNGIAIPEVAELLELARQRETWLAQMLGAYADLFRPPVAK
KTPKTDVTQPLIQAVNLDEPEHPALSRAELESWRSDLKGLVRRFRDALSEC
Download sequence
Identical sequences A0A059UZ33 A0A0C1I596 F8FUP5 V9UZQ8
gi|339486628|ref|YP_004701156.1| 2035964823 WP_013971715.1.23948 WP_013971715.1.28354 WP_013971715.1.35335 WP_013971715.1.56258 WP_013971715.1.65739 WP_013971715.1.7288 WP_013971715.1.7435 gi|568186553|ref|YP_008959088.1| gi|568181122|ref|YP_008953659.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]