SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568187448|ref|YP_008960046.1| from Pseudomonas monteilii SB3101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568187448|ref|YP_008960046.1|
Domain Number 1 Region: 5-175
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 1.18e-32
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568187448|ref|YP_008960046.1|
Sequence length 177
Comment cytochrome B561 [Pseudomonas monteilii SB3101]
Sequence
MKTDAFHPLARLLHWLMAVLILAMLFIGVSMVADLSPRHPVLIGLHKATGLALLVLVLLR
IAVRLALPHPALPRDLPALQRWGAGASHLVLYGLMLAMPLLGWAMLSAGGYPRPLGLPAI
APHDLQLYAVLRQAHGWAGYLLFATVLVHVGAALMHAWVRRDGVLRSMWPGPLRRSQ
Download sequence
Identical sequences A0A059UWB7 F8FSH2 V9V2A8
gi|568182068|ref|YP_008954676.1| gi|568187448|ref|YP_008960046.1| gi|339487462|ref|YP_004701990.1| WP_013972482.1.23948 WP_013972482.1.28354 WP_013972482.1.35335 WP_013972482.1.56258 WP_013972482.1.65739 WP_013972482.1.7288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]