SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568187897|ref|YP_008960515.1| from Pseudomonas monteilii SB3101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568187897|ref|YP_008960515.1|
Domain Number 1 Region: 3-233
Classification Level Classification E-value
Superfamily ClpP/crotonase 6.83e-39
Family Biotin dependent carboxylase carboxyltransferase domain 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568187897|ref|YP_008960515.1|
Sequence length 282
Comment malonate decarboxylase subunit beta [Pseudomonas monteilii SB3101]
Sequence
MTDIARLLHSRSFVELGARQRARAVLDPGSFRELLGPFDRLMSPWLPRQGIVPQADDGVV
IAKGLLNGRNAVVAAIEGGFQGGSMGEVGGAKIAGALELAIEDNRNGIPTCAVLLLETGG
VRLQEANLGLAAIAEIQAAIVELRAWQPVVGLVAGSVGCFGGMSIAAGLCSHLLVTREAR
LGLNGPQVIEQEAGIGEYDAKDRPFIWSLTGGEQRHASGLVDAYVADDIEALRERLLQLL
DEPSRDRAGQHAWFLERLARLGDDCTQLDAAAVRDLYQGEAK
Download sequence
Identical sequences V9UYW5
gi|568187897|ref|YP_008960515.1| WP_024087233.1.23948 WP_024087233.1.28354 WP_024087233.1.7288 gi|568182519|ref|YP_008955147.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]