SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568188302|ref|YP_008960936.1| from Pseudomonas monteilii SB3101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568188302|ref|YP_008960936.1|
Domain Number 1 Region: 2-269
Classification Level Classification E-value
Superfamily ClpP/crotonase 3.06e-79
Family Crotonase-like 0.000000167
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568188302|ref|YP_008960936.1|
Sequence length 270
Comment enoyl-CoA hydratase [Pseudomonas monteilii SB3101]
Sequence
MTEYSAFKVELTNSIAHVQINRPDKRNAMNAAFWEEIIDIFQWVDDTDAVRAVVISGAGK
HFSAGIDLMMLASLAGQMGKDVGRNARFLRSTILRLQASFNAVDKCRKPVLAAVQGYCIG
GAIDLISACDMRYCSSDAQFSIKEIDMGMAADVGTLQRLPRIIGDGMMRELAFTGRNVEA
EEALRIGLVNRVYDDQAALMDGVFAIAGEIAAKSPIAVAGTKEMLSYMRDHRIDDGLEYI
ATWNAAMLQSEDLRVAVAAHMSKQKPTFAD
Download sequence
Identical sequences A0A059UUQ1 A0A099N1E9 A0A136QGJ5 F8G5T2 V7DF89 V9UZZ7
gi|568188302|ref|YP_008960936.1| gi|339488333|ref|YP_004702861.1| gi|568182924|ref|YP_008955568.1| WP_013973305.1.1643 WP_013973305.1.23948 WP_013973305.1.28354 WP_013973305.1.32670 WP_013973305.1.35335 WP_013973305.1.56258 WP_013973305.1.59340 WP_013973305.1.65739 WP_013973305.1.7288 WP_013973305.1.80759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]