SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568189354|ref|YP_008962034.1| from Pseudomonas monteilii SB3101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568189354|ref|YP_008962034.1|
Domain Number 1 Region: 5-175
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 4.39e-33
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568189354|ref|YP_008962034.1|
Sequence length 177
Comment cytochrome B561 [Pseudomonas monteilii SB3101]
Sequence
MNSDGTVQLWDPLLRLCHWSIAVVFFANYFFNEEGEDWHQWLGYYALAVVVVRVVWGFVG
PRSARWADFWPSPASLVGHARALLHGGLDHHMGHSPIGALVMVLMLTCIAGLGLTGWASQ
EVDALFGVDWPMDLHSWLANALLVLVCVHVLAAIYESVRMRENLPWSMITGRRRHRD
Download sequence
Identical sequences A0A059V5A2 A0A0C1KJB9 A0A2A3M5G3 V7DCK2 V9V4P9
gi|568183981|ref|YP_008956671.1| gi|568189354|ref|YP_008962034.1| WP_023661197.1.1643 WP_023661197.1.23948 WP_023661197.1.28354 WP_023661197.1.35335 WP_023661197.1.65739 WP_023661197.1.7288 WP_023661197.1.7435 WP_023661197.1.80759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]