SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568189563|ref|YP_008962245.1| from Pseudomonas monteilii SB3101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568189563|ref|YP_008962245.1|
Domain Number 1 Region: 110-143
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000772
Family NfeD domain-like 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568189563|ref|YP_008962245.1|
Sequence length 145
Comment hypothetical protein X970_22710 [Pseudomonas monteilii SB3101]
Sequence
MEMQWWIWLVFGIALILLELVLPTFFILWFGIGAVLVSLISLAAPSLQLDMQVLLWVLMS
SVTTALWFKLFRRKQPDVRWTAESVIGEVGLLTAGVSEFQKGRVRFQKPILGNEEWTCIA
DSEIAAGERVRLTAIEGNTARVIRA
Download sequence
Identical sequences A0A059UY08 A0A099N4K5 A0A136QJI0 F8FST0 J8VEB5 L0FRG8 V7DDC6 V9V8C4
gi|339489560|ref|YP_004704088.1| gi|568184190|ref|YP_008956882.1| WP_003257542.1.1643 WP_003257542.1.23948 WP_003257542.1.28354 WP_003257542.1.35335 WP_003257542.1.56258 WP_003257542.1.57632 WP_003257542.1.65739 WP_003257542.1.71677 WP_003257542.1.7288 WP_003257542.1.80759 gi|568189563|ref|YP_008962245.1| 2036031439 gi|431804653|ref|YP_007231556.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]