SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568189780|ref|YP_008962467.1| from Pseudomonas monteilii SB3101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568189780|ref|YP_008962467.1|
Domain Number 1 Region: 46-127,200-377
Classification Level Classification E-value
Superfamily ClpP/crotonase 3.31e-83
Family Tail specific protease, catalytic domain 0.00013
Further Details:      
 
Domain Number 2 Region: 99-182
Classification Level Classification E-value
Superfamily PDZ domain-like 3.68e-19
Family PDZ domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568189780|ref|YP_008962467.1|
Sequence length 438
Comment peptidase S41 [Pseudomonas monteilii SB3101]
Sequence
MLHSPRLTQLALSIALAVGAPLVTAAEPAKPAAVPATEVTAKAPLPLEELRTFAEVMDRI
KAAYVEPVDDKTLLENAIKGMLSNLDPHSAYLGPEDFQELQESTSGEFGGLGIEVGQEDG
FIKVVSPIDDTPASRAGVQAGDLIVKINGAPTRGQTMTEAVDKMRGKVGEKITLTLVRDG
GNPFDVTLARAVIQVKSVKSQLLENDYGYIRITQFQVKTGDEVGKALAKLRKDNGKKLRG
VVLDLRNNPGGVLQSAVEVADHFLTKGLIVYTKGRIANSELRFSADPADASDGVPLVVLI
NGGSASASEIVAGALQDQKRAVLMGTDSFGKGSVQTVLPLANDRALKLTTALYFTPNGRS
IQAQGIVPDIEVRPAKLTAEADTDNFKEADLQGHLGNGNGGADRPTGSGKRKERPQDDDF
QLSQALSLLKGLNITKGD
Download sequence
Identical sequences F8FWN5 V9V6M0
gi|568184407|ref|YP_008957104.1| WP_013974584.1.23948 WP_013974584.1.28354 WP_013974584.1.56258 WP_013974584.1.65739 WP_013974584.1.7288 gi|339489783|ref|YP_004704311.1| gi|568189780|ref|YP_008962467.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]