SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568187535|ref|YP_008960134.1| from Pseudomonas monteilii SB3101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568187535|ref|YP_008960134.1|
Domain Number 1 Region: 39-206
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.87e-37
Family Clp protease, ClpP subunit 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568187535|ref|YP_008960134.1|
Sequence length 388
Comment ATP-dependent Clp protease ClpP [Pseudomonas monteilii SB3101]
Sequence
MKPLMPFRIFNKAKALLPVEDGHWYSITAAAPEGDAGSKVIEVYVYGEIGAWGITANQFI
QELKAVDDGVSPVVVAFNTNGGDLFEGLAIHNALSRLGERCTGRVDALAASAGSVAVCGA
HRVVMASNAMLMIHNPYTWAGGDADELRRVADVLDQAFEVIIAAYKAKAPDIDEDELRRL
VNAETWLTASEALALGLADEVGDGVKVQACLGQGAAMARYRNTPQALLDQLKASKDEPTE
PVVNEPENEPAVPQPTASDSTALALMITKACTQAGISNLVEPLIASTKLADEATVQAALT
RAKAVRDLCVAARLPEMTGEYVQAGLDATAVRVRLFDKLVGNGKGFEIDNSLPPADDLPE
KVQAKAPNPSGIWAARRQATQPRPGQGA
Download sequence
Identical sequences V9V052
gi|568182157|ref|YP_008954766.1| gi|568187535|ref|YP_008960134.1| WP_024087072.1.23948 WP_024087072.1.28354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]