SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568189521|ref|YP_008962203.1| from Pseudomonas monteilii SB3101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568189521|ref|YP_008962203.1|
Domain Number 1 Region: 5-226,421-675
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.99e-151
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000000771
Further Details:      
 
Domain Number 2 Region: 226-419
Classification Level Classification E-value
Superfamily ValRS/IleRS/LeuRS editing domain 3.03e-50
Family ValRS/IleRS/LeuRS editing domain 0.0000086
Further Details:      
 
Domain Number 3 Region: 670-867
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 8.41e-38
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568189521|ref|YP_008962203.1|
Sequence length 868
Comment leucyl-tRNA synthetase [Pseudomonas monteilii SB3101]
Sequence
MHEQYTPRDIEAAAQKFWDEQQSFAVTEQPGKDTYYCLSMFPYPSGKLHMGHVRNYTIGD
VIARYQRMLGKNVLQPMGWDAFGMPAENAAMKNNVAPAKWTYENIDYMKTQLKSLGLAID
WAREVTTCKPDYYRWEQWLFTRLFEKGIIYRKNGTVNWDPADQTVLANEQVIDGRGWRSG
ALIEKREIPMYYFRITDYADELLESLDELPGWPEQVKTMQRNWIGKSRGMEVQFPYDLAS
IGHEGTLKVFTTRPDTLMGATYVAVAAEHPLATQAAQGNPALQAFIDECKSGSVAEADMA
TQEKKGMATSLLVEHPLTGEKLPVWVANYVLMHYGDGAVMAVPAHDERDFEFAHKYNLPV
KAVVRTSAGDEVGNEWLAAYGEHGQLINSGEFDGLDFAGAFDAIEAALIRKELGKSRTQF
RLRDWGISRQRYWGCPIPIIHCPSCGDVPVPEDQLPVTLPENVVPDGAGSPLARMPEFYE
CNCPKCGTAAKRETDTMDTFVESSWYFARYASPNYEGGMVDPKAANHWLPVDQYIGGIEH
AILHLLYARFFHKLMRDEGLVTSNEPFKNLLTQGMVVAETYYRVASNGGKDWFNPADVEV
ERDAKAKIIGARLKTDGLPVEIGGTEKMSKSKNNGVDPQSMIDQYGADTCRLFMMFASPP
DMSLEWSDSGVEGASRFLRRVWRLAQAHVAQGLPGKLDVAALDDAQKVIRRAIHAAIKQA
STDVGQFHKFNTAIAQVMTVMNVLEKAPQATEQDRALLQEGLEAVTLLLAPITPHISHEL
WQQLGHQQAVIDASWPAVDEAALVQDTVTLVVQVNGKLRGQVEMPAAASREEIEAAARSN
ENVLRFIDGLTIRKVIVVPGKLVNIVAN
Download sequence
Identical sequences V9V6V8
gi|568184148|ref|YP_008956840.1| WP_024087787.1.23948 WP_024087787.1.28354 gi|568189521|ref|YP_008962203.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]