SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392981241|ref|YP_006479829.1| from Enterobacter cloacae subsp. dissolvens SDM

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392981241|ref|YP_006479829.1|
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 4.71e-39
Family Frataxin-like 0.000000997
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|392981241|ref|YP_006479829.1|
Sequence length 106
Comment frataxin-like protein [Enterobacter cloacae subsp. dissolvens SDM]
Sequence
MNDSEFHRLADTLWMTIEERLDDWEGDSDIDCEINGGILTLSFENGSKIIINRQEPLHQV
WLAARQGGYHFDLKGDEWVCDRSGETFWDLLEQAATAQAGEEVSFR
Download sequence
Identical sequences WP_014833711.1.71263 gi|392981241|ref|YP_006479829.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]