SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392978442|ref|YP_006477030.1| from Enterobacter cloacae subsp. dissolvens SDM

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392978442|ref|YP_006477030.1|
Domain Number 1 Region: 98-214
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 7.07e-26
Family Aromatic dioxygenase reductase-like 0.0079
Further Details:      
 
Domain Number 2 Region: 202-311
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 4.72e-23
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0044
Further Details:      
 
Domain Number 3 Region: 2-95
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.19e-20
Family Ferredoxin reductase FAD-binding domain-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|392978442|ref|YP_006477030.1|
Sequence length 313
Comment (hypo)xanthine hydroxylase reductase [Enterobacter cloacae subsp. dissolvens SDM]
Sequence
MLSVIVDGLWRQGNKSLAVRLVAENGEALPEWQPGAHIDVHLPCGVIRQYSLTDSCENEG
YLICVGRETASRGGSRYIHETLRPGQKLLISAPRNLFALQEAEQVLLLAAGIGITPLYAM
ALALEAAGTPFTLHYYVRQAESAAFARELSQIEQGNCVIHTTSPRTLLAEHIPVATAGLH
AWVCGPAGFMEKVRDVATAKGWDEAHLHSEAFQPAAPVSGGEAGEIFTVKLASTGERWPV
PADKTIAQVLQENGVDVPLSCEMGICGACLTPVIDGVVDHRDSVQSEAEKNGPDQQVALC
CSRSHSGELVIGL
Download sequence
Identical sequences gi|392978442|ref|YP_006477030.1| WP_014831347.1.71263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]