SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392978920|ref|YP_006477508.1| from Enterobacter cloacae subsp. dissolvens SDM

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392978920|ref|YP_006477508.1|
Domain Number 1 Region: 94-242
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 7.99e-33
Family Flavohemoglobin, C-terminal domain 0.059
Further Details:      
 
Domain Number 2 Region: 236-350
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 6.47e-28
Family 2Fe-2S ferredoxin-related 0.011
Further Details:      
 
Domain Number 3 Region: 2-103
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 5.11e-23
Family Ferredoxin reductase FAD-binding domain-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|392978920|ref|YP_006477508.1|
Sequence length 356
Comment phenylacetate-CoA oxygenase, NAD(P)H oxidoreductase component [Enterobacter cloacae subsp. dissolvens SDM]
Sequence
MTTFHSLTVAKVEPETRDAVTITFAVPQALQEAYRFRPGQHLTLKTRLGADELRRCYSIC
RSSAPGEISVAVKAIEGGRFSRYARDEIKPGMTLEVMVPQGHFGYQPQPEREGHYLAIAA
GSGITPMLAILSATLAAEPNSHFTLIYGNRSSQSMMFRQALADLKDKYPQRLQLVAIFSQ
ERLDSDLLYGRIDGEKLQALAKTLINFRQYDEAFICGPAAMMDEAETTLKALGMAEKSLH
LERFNTPGTAVKRAVSVQAEGQKVIVRQDGRDREIVLTADDDSILDAALRQGADLPYACK
GGVCATCKCKVLRGQVDMATNYSLEPDELAAGYVLSCQALPLTADVVVDFDAKGMA
Download sequence
Identical sequences WP_014831760.1.43855 WP_014831760.1.71263 gi|392978920|ref|YP_006477508.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]