SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|526461868|ref|YP_008332614.1| from Anaplasma phagocytophilum str. HZ2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|526461868|ref|YP_008332614.1|
Domain Number 1 Region: 135-350
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.6e-42
Family Extended AAA-ATPase domain 0.0000144
Further Details:      
 
Domain Number 2 Region: 368-471
Classification Level Classification E-value
Superfamily TrpR-like 6.8e-35
Family Chromosomal replication initiation factor DnaA C-terminal domain IV 0.0000885
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|526461868|ref|YP_008332614.1|
Sequence length 472
Comment chromosomal replication initiation protein [Anaplasma phagocytophilum str. HZ2]
Sequence
MGNSGATDCNVGTMDRDSTYDGHLSWQSVQKKLRDFYGSAAYDSWLSALVYSGYENGRVI
LLVPTRFIKEWILVHYLEKILEYWRGENSAVYCIDICVADGAESSVLQGNRGVSVRSTEA
QEVSSVSTYEHLSSPLDPRFTFDNFVVGKPNELAFAAARRVAESSEPIPGSNPLFLYGGV
GLGKTHLMHAIAWYALGSPRKRKIAYLSAEKFMYQYVTALRSKDIMLFKEQFRSVDVLMV
DDVQFISGKDSTQEEFFHTFNALIDQSKQLVISADRSPSDLDGVEDRIKSRLGWGLVADI
NETTFELRLGILQLKVEKMGIHVPDEVLEFLAKNIKSNIRELEGALNKVVAHSSLVGSSV
TVELASDILSDLLRANHRLVTIDAIQKKVAEFFGIRLEDMYSARRLRALARPRQVAMYLS
KRLTQKSLPDIGKSFGGRDHATVIHAVKQVEKFIDTDSKLAGDISLLIRMLR
Download sequence
Identical sequences A0A0F3NDG4 A0A0F3Q0W5
gi|526461868|ref|YP_008332614.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]