SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|365968513|ref|YP_004950074.1| from Enterobacter cloacae EcWSU1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|365968513|ref|YP_004950074.1|
Domain Number 1 Region: 1-100
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 6.28e-34
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|365968513|ref|YP_004950074.1|
Sequence length 105
Comment N,N'-diacetylchitobiose-specific phosphotransferase enzyme IIA component [Enterobacter cloacae EcWSU1]
Sequence
MEDLETTIMELLVNAGAARSAALTALQMARKGDFDEAEKAMEESREYVKHAHTIQTQLIG
LDEGTGKLPVNLITVHSQDHLMNAMVIQDLAGDMIELYRRLPLIN
Download sequence
Identical sequences G8LGQ9 W0BV00
WP_014168157.1.10612 WP_014168157.1.13522 WP_014168157.1.14229 WP_014168157.1.15096 WP_014168157.1.20346 WP_014168157.1.21139 WP_014168157.1.2196 WP_014168157.1.21963 WP_014168157.1.24084 WP_014168157.1.25650 WP_014168157.1.27882 WP_014168157.1.40582 WP_014168157.1.40638 WP_014168157.1.40945 WP_014168157.1.49197 WP_014168157.1.57391 WP_014168157.1.58693 WP_014168157.1.64616 WP_014168157.1.75814 WP_014168157.1.79393 WP_014168157.1.86083 WP_014168157.1.88986 WP_014168157.1.89102 WP_014168157.1.91166 WP_014168157.1.92699 WP_014168157.1.9451 WP_014168157.1.98015 WP_014168157.1.98207 WP_014168157.1.98616 gi|365968513|ref|YP_004950074.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]