SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384512253|ref|YP_005707346.1| from Enterococcus faecalis OG1RF

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384512253|ref|YP_005707346.1|
Domain Number 1 Region: 16-137
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.86e-28
Family MarR-like transcriptional regulators 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384512253|ref|YP_005707346.1|
Sequence length 144
Comment MarR family transcriptional regulator [Enterococcus faecalis OG1RF]
Sequence
MSLSLREVSQLLCQLKVLDQKITKVFEEQVGLSLTRYELLMILKERQPCLQTEIQEHLKI
DSGAVTRHLKILEEKQYVTRQRNPENNREVLVHLTEKAQQELQQCTAKQQTVTEIIPSTF
TKDDCRQLKELLTKLDQSITTKEV
Download sequence
Identical sequences A0A059N3S1 A0A0E9EN47 A0A0M2AEN7 A0A0M2AWB5 A0A0M2CNM7 A0A0U1AQM2 A0A0Y4DVA6 A0A0Y7IX95 A0A125W4H8 A0A1G1SB21 A0A1R4K6C5 C0X6C7 C7V8C1 C7WVA9 D4EJ06 D4ET13 E0HBM5 E2YAX2 E2YJI6 E2YZ44 E6F2U2 E6GLJ9 E6GSI2 E6H3Y6 E6IDM8 J5BGH7 J6AVV5 J6CB69 J6DKR5 J6EBY6 J6ENJ2 J6FL36 J6MBU9 J6MQG2 J6PHN2 J6PRL2 J6Q4G6 J6QDF7 J6QZT1 J6R2Q7 J6R8X9 Q838N6 R3K0H8 R3KQS9 U6RZM3 V7ZPB7
APC28787 gi|29375039|ref|NP_814192.1| gi|397698917|ref|YP_006536705.1| NP_814192.1.90627 WP_002362972.1.100343 WP_002362972.1.100390 WP_002362972.1.100415 WP_002362972.1.10042 WP_002362972.1.100482 WP_002362972.1.101272 WP_002362972.1.101275 WP_002362972.1.101479 WP_002362972.1.101818 WP_002362972.1.101914 WP_002362972.1.102128 WP_002362972.1.10330 WP_002362972.1.10696 WP_002362972.1.10758 WP_002362972.1.11048 WP_002362972.1.11193 WP_002362972.1.11284 WP_002362972.1.11459 WP_002362972.1.11651 WP_002362972.1.11776 WP_002362972.1.12145 WP_002362972.1.12235 WP_002362972.1.12247 WP_002362972.1.12449 WP_002362972.1.12625 WP_002362972.1.12630 WP_002362972.1.12889 WP_002362972.1.12926 WP_002362972.1.13021 WP_002362972.1.13365 WP_002362972.1.13369 WP_002362972.1.1344 WP_002362972.1.13739 WP_002362972.1.14157 WP_002362972.1.14180 WP_002362972.1.14269 WP_002362972.1.14402 WP_002362972.1.14420 WP_002362972.1.14485 WP_002362972.1.14750 WP_002362972.1.14792 WP_002362972.1.15224 WP_002362972.1.15286 WP_002362972.1.15458 WP_002362972.1.15543 WP_002362972.1.15705 WP_002362972.1.1595 WP_002362972.1.16241 WP_002362972.1.16763 WP_002362972.1.17164 WP_002362972.1.17287 WP_002362972.1.17682 WP_002362972.1.17799 WP_002362972.1.17800 WP_002362972.1.1799 WP_002362972.1.18048 WP_002362972.1.18259 WP_002362972.1.18260 WP_002362972.1.18390 WP_002362972.1.18475 WP_002362972.1.18524 WP_002362972.1.18709 WP_002362972.1.19115 WP_002362972.1.1948 WP_002362972.1.19601 WP_002362972.1.19675 WP_002362972.1.19734 WP_002362972.1.19902 WP_002362972.1.19951 WP_002362972.1.20029 WP_002362972.1.20659 WP_002362972.1.2067 WP_002362972.1.20674 WP_002362972.1.21993 WP_002362972.1.22059 WP_002362972.1.2207 WP_002362972.1.22780 WP_002362972.1.22796 WP_002362972.1.23017 WP_002362972.1.23054 WP_002362972.1.23319 WP_002362972.1.23569 WP_002362972.1.24023 WP_002362972.1.24064 WP_002362972.1.24526 WP_002362972.1.24581 WP_002362972.1.246 WP_002362972.1.24743 WP_002362972.1.25180 WP_002362972.1.25583 WP_002362972.1.25702 WP_002362972.1.25704 WP_002362972.1.26187 WP_002362972.1.26451 WP_002362972.1.27081 WP_002362972.1.27216 WP_002362972.1.274 WP_002362972.1.2799 WP_002362972.1.2801 WP_002362972.1.28038 WP_002362972.1.28185 WP_002362972.1.28221 WP_002362972.1.28428 WP_002362972.1.28487 WP_002362972.1.28579 WP_002362972.1.28817 WP_002362972.1.28932 WP_002362972.1.28980 WP_002362972.1.29097 WP_002362972.1.29627 WP_002362972.1.29985 WP_002362972.1.3016 WP_002362972.1.30275 WP_002362972.1.30586 WP_002362972.1.30609 WP_002362972.1.31324 WP_002362972.1.31326 WP_002362972.1.31656 WP_002362972.1.31869 WP_002362972.1.32099 WP_002362972.1.32265 WP_002362972.1.32385 WP_002362972.1.33139 WP_002362972.1.33306 WP_002362972.1.33460 WP_002362972.1.33513 WP_002362972.1.33574 WP_002362972.1.33685 WP_002362972.1.33798 WP_002362972.1.33851 WP_002362972.1.34192 WP_002362972.1.34256 WP_002362972.1.34766 WP_002362972.1.34947 WP_002362972.1.34999 WP_002362972.1.35171 WP_002362972.1.35449 WP_002362972.1.35810 WP_002362972.1.35823 WP_002362972.1.36198 WP_002362972.1.36209 WP_002362972.1.36269 WP_002362972.1.3645 WP_002362972.1.36880 WP_002362972.1.36900 WP_002362972.1.37181 WP_002362972.1.37810 WP_002362972.1.37996 WP_002362972.1.38725 WP_002362972.1.3909 WP_002362972.1.39119 WP_002362972.1.39771 WP_002362972.1.39932 WP_002362972.1.4014 WP_002362972.1.40357 WP_002362972.1.4071 WP_002362972.1.40757 WP_002362972.1.40908 WP_002362972.1.41053 WP_002362972.1.41792 WP_002362972.1.42353 WP_002362972.1.42483 WP_002362972.1.42904 WP_002362972.1.42908 WP_002362972.1.43540 WP_002362972.1.43903 WP_002362972.1.43994 WP_002362972.1.44185 WP_002362972.1.44242 WP_002362972.1.44501 WP_002362972.1.44537 WP_002362972.1.44626 WP_002362972.1.4487 WP_002362972.1.45269 WP_002362972.1.45484 WP_002362972.1.455 WP_002362972.1.45643 WP_002362972.1.45860 WP_002362972.1.45925 WP_002362972.1.46056 WP_002362972.1.46113 WP_002362972.1.46346 WP_002362972.1.46348 WP_002362972.1.46357 WP_002362972.1.46606 WP_002362972.1.46621 WP_002362972.1.47172 WP_002362972.1.47217 WP_002362972.1.47407 WP_002362972.1.47856 WP_002362972.1.47867 WP_002362972.1.48063 WP_002362972.1.48126 WP_002362972.1.48153 WP_002362972.1.48676 WP_002362972.1.49131 WP_002362972.1.49392 WP_002362972.1.49646 WP_002362972.1.4975 WP_002362972.1.49914 WP_002362972.1.49961 WP_002362972.1.50067 WP_002362972.1.50115 WP_002362972.1.50513 WP_002362972.1.50810 WP_002362972.1.5083 WP_002362972.1.50938 WP_002362972.1.51046 WP_002362972.1.5113 WP_002362972.1.51694 WP_002362972.1.51712 WP_002362972.1.52575 WP_002362972.1.52614 WP_002362972.1.52926 WP_002362972.1.53279 WP_002362972.1.53342 WP_002362972.1.53631 WP_002362972.1.53989 WP_002362972.1.54277 WP_002362972.1.54652 WP_002362972.1.54795 WP_002362972.1.54934 WP_002362972.1.54998 WP_002362972.1.55065 WP_002362972.1.56483 WP_002362972.1.5680 WP_002362972.1.56974 WP_002362972.1.57048 WP_002362972.1.57136 WP_002362972.1.57163 WP_002362972.1.57211 WP_002362972.1.57242 WP_002362972.1.57302 WP_002362972.1.57542 WP_002362972.1.57671 WP_002362972.1.57705 WP_002362972.1.57758 WP_002362972.1.57968 WP_002362972.1.58089 WP_002362972.1.58620 WP_002362972.1.5872 WP_002362972.1.58766 WP_002362972.1.59454 WP_002362972.1.59564 WP_002362972.1.59645 WP_002362972.1.59658 WP_002362972.1.59690 WP_002362972.1.59698 WP_002362972.1.5994 WP_002362972.1.59964 WP_002362972.1.60200 WP_002362972.1.60361 WP_002362972.1.60394 WP_002362972.1.60422 WP_002362972.1.60579 WP_002362972.1.60776 WP_002362972.1.61083 WP_002362972.1.61089 WP_002362972.1.61103 WP_002362972.1.61290 WP_002362972.1.61503 WP_002362972.1.61932 WP_002362972.1.62847 WP_002362972.1.62949 WP_002362972.1.6312 WP_002362972.1.63148 WP_002362972.1.63158 WP_002362972.1.63477 WP_002362972.1.63507 WP_002362972.1.63848 WP_002362972.1.63884 WP_002362972.1.64022 WP_002362972.1.64483 WP_002362972.1.6473 WP_002362972.1.65210 WP_002362972.1.65397 WP_002362972.1.65461 WP_002362972.1.6626 WP_002362972.1.66308 WP_002362972.1.66316 WP_002362972.1.66403 WP_002362972.1.6682 WP_002362972.1.66843 WP_002362972.1.66845 WP_002362972.1.66898 WP_002362972.1.66902 WP_002362972.1.67436 WP_002362972.1.67615 WP_002362972.1.67683 WP_002362972.1.67716 WP_002362972.1.68409 WP_002362972.1.68746 WP_002362972.1.6893 WP_002362972.1.69290 WP_002362972.1.69336 WP_002362972.1.69521 WP_002362972.1.69648 WP_002362972.1.69824 WP_002362972.1.70043 WP_002362972.1.70756 WP_002362972.1.70799 WP_002362972.1.71303 WP_002362972.1.71406 WP_002362972.1.71499 WP_002362972.1.71510 WP_002362972.1.71725 WP_002362972.1.72058 WP_002362972.1.72077 WP_002362972.1.72635 WP_002362972.1.72733 WP_002362972.1.73695 WP_002362972.1.73824 WP_002362972.1.74362 WP_002362972.1.74389 WP_002362972.1.74591 WP_002362972.1.75211 WP_002362972.1.75297 WP_002362972.1.75486 WP_002362972.1.75949 WP_002362972.1.76074 WP_002362972.1.76128 WP_002362972.1.76646 WP_002362972.1.77327 WP_002362972.1.77328 WP_002362972.1.77357 WP_002362972.1.7815 WP_002362972.1.7819 WP_002362972.1.78447 WP_002362972.1.78471 WP_002362972.1.78503 WP_002362972.1.78641 WP_002362972.1.79457 WP_002362972.1.7958 WP_002362972.1.79791 WP_002362972.1.80104 WP_002362972.1.80396 WP_002362972.1.80452 WP_002362972.1.80556 WP_002362972.1.8058 WP_002362972.1.80867 WP_002362972.1.80889 WP_002362972.1.80976 WP_002362972.1.81312 WP_002362972.1.81327 WP_002362972.1.81459 WP_002362972.1.81575 WP_002362972.1.81991 WP_002362972.1.82160 WP_002362972.1.82202 WP_002362972.1.82555 WP_002362972.1.82993 WP_002362972.1.83032 WP_002362972.1.83490 WP_002362972.1.83649 WP_002362972.1.8380 WP_002362972.1.84260 WP_002362972.1.84380 WP_002362972.1.84469 WP_002362972.1.84573 WP_002362972.1.84632 WP_002362972.1.84813 WP_002362972.1.85534 WP_002362972.1.8575 WP_002362972.1.85848 WP_002362972.1.85862 WP_002362972.1.85945 WP_002362972.1.85963 WP_002362972.1.86134 WP_002362972.1.86666 WP_002362972.1.86904 WP_002362972.1.87277 WP_002362972.1.87385 WP_002362972.1.87482 WP_002362972.1.8794 WP_002362972.1.88329 WP_002362972.1.88464 WP_002362972.1.88661 WP_002362972.1.8901 WP_002362972.1.89060 WP_002362972.1.89088 WP_002362972.1.89431 WP_002362972.1.8960 WP_002362972.1.89791 WP_002362972.1.90047 WP_002362972.1.90100 WP_002362972.1.90371 WP_002362972.1.90503 WP_002362972.1.90642 WP_002362972.1.90872 WP_002362972.1.91092 WP_002362972.1.91394 WP_002362972.1.91555 WP_002362972.1.9159 WP_002362972.1.91813 WP_002362972.1.91925 WP_002362972.1.92037 WP_002362972.1.92073 WP_002362972.1.9214 WP_002362972.1.92348 WP_002362972.1.92581 WP_002362972.1.92820 WP_002362972.1.93159 WP_002362972.1.93277 WP_002362972.1.93642 WP_002362972.1.93977 WP_002362972.1.94041 WP_002362972.1.94506 WP_002362972.1.94630 WP_002362972.1.94964 WP_002362972.1.95212 WP_002362972.1.95228 WP_002362972.1.95340 WP_002362972.1.95445 WP_002362972.1.95493 WP_002362972.1.95534 WP_002362972.1.95629 WP_002362972.1.9570 WP_002362972.1.95935 WP_002362972.1.95970 WP_002362972.1.95971 WP_002362972.1.96320 WP_002362972.1.96467 WP_002362972.1.96481 WP_002362972.1.96745 WP_002362972.1.96764 WP_002362972.1.96987 WP_002362972.1.97078 WP_002362972.1.97268 WP_002362972.1.97643 WP_002362972.1.98078 WP_002362972.1.9842 WP_002362972.1.98652 WP_002362972.1.98868 WP_002362972.1.99 WP_002362972.1.99014 WP_002362972.1.99022 WP_002362972.1.9925 WP_002362972.1.99432 WP_002362972.1.99543 WP_002362972.1.99748 226185.EF0403 gi|384512253|ref|YP_005707346.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]