SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384512781|ref|YP_005707874.1| from Enterococcus faecalis OG1RF

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384512781|ref|YP_005707874.1|
Domain Number 1 Region: 2-100
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.48e-28
Family HxlR-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384512781|ref|YP_005707874.1|
Sequence length 101
Comment phage integrase family site-specific recombinase [Enterococcus faecalis OG1RF]
Sequence
MNNNNCGVSKVMDILGGKWKLKILWVLSQHPSIRFNQLKREVDGITNVMLTRCLETLADV
HLVKRTDYHEIPPKVDYALTDKGKELVPSLLFLNDWGKSNL
Download sequence
Identical sequences A0A2G9QQR5
WP_002414384.1.101914 WP_002414384.1.61089 WP_002414384.1.6626 gi|384512781|ref|YP_005707874.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]