SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384512856|ref|YP_005707949.1| from Enterococcus faecalis OG1RF

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384512856|ref|YP_005707949.1|
Domain Number 1 Region: 12-110
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.27e-25
Family HxlR-like 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384512856|ref|YP_005707949.1|
Sequence length 114
Comment transcriptional regulator [Enterococcus faecalis OG1RF]
Sequence
MEKVKTESFVLCPKFEKSFSILGKKWNGLIIDVLLERGPQRFGELKEKIPMLSDRVLVER
LKELEAEGIITKAVRCGEGNRLEYFLTEKGEDLQLAMEQIQHWAEKWVKDEECS
Download sequence
Identical sequences A0A059N0G0 A0A0E9EED6 A0A0H1UAI6 A0A0M2ACB3 A0A0M2ARI9 A0A0M2CL59 A0A0U1AD32 A0A111U6T6 A0A112UKA6 A0A125W841 A0A1B4XMN8 A0A1R4L6A7 C0X4G3 C7D4K5 C7VBN2 C7X2Y7 D4EJZ0 D4EUI3 E0HCR7 E2Y9G3 E2YI85 E2YVM9 E6EZS2 E6GMX9 E6GRA4 E6H770 E6IE31 J5E674 J5FPU8 J5H503 J5Z5B0 J6ALM5 J6AYP7 J6BHK3 J6D8I5 J6DY22 J6EKW9 J6F651 J6N5Z8 J6PIS1 J6Q584 J6RA76 J6RGG5 Q836J7 R3GWR9 R3I984 S4CBW9 S4FGV2 S4FHY0 U6S3J4 V7ZRH4
gi|397699501|ref|YP_006537289.1| APC28974 EfR14 gi|29375690|ref|NP_814844.1| gi|384518220|ref|YP_005705525.1| NP_814844.1.90627 WP_002358035.1.100343 WP_002358035.1.100390 WP_002358035.1.100415 WP_002358035.1.10042 WP_002358035.1.100482 WP_002358035.1.101272 WP_002358035.1.101275 WP_002358035.1.101479 WP_002358035.1.101808 WP_002358035.1.101818 WP_002358035.1.102128 WP_002358035.1.10330 WP_002358035.1.10696 WP_002358035.1.10758 WP_002358035.1.11048 WP_002358035.1.11193 WP_002358035.1.11284 WP_002358035.1.11459 WP_002358035.1.11651 WP_002358035.1.11776 WP_002358035.1.12145 WP_002358035.1.12235 WP_002358035.1.12247 WP_002358035.1.12449 WP_002358035.1.12625 WP_002358035.1.12630 WP_002358035.1.12825 WP_002358035.1.12889 WP_002358035.1.1291 WP_002358035.1.12926 WP_002358035.1.13021 WP_002358035.1.13365 WP_002358035.1.13369 WP_002358035.1.1344 WP_002358035.1.13739 WP_002358035.1.14157 WP_002358035.1.14180 WP_002358035.1.14269 WP_002358035.1.14402 WP_002358035.1.14420 WP_002358035.1.14485 WP_002358035.1.14750 WP_002358035.1.14792 WP_002358035.1.15224 WP_002358035.1.15286 WP_002358035.1.15458 WP_002358035.1.15543 WP_002358035.1.15705 WP_002358035.1.1595 WP_002358035.1.16241 WP_002358035.1.16763 WP_002358035.1.17164 WP_002358035.1.17287 WP_002358035.1.17682 WP_002358035.1.17799 WP_002358035.1.17800 WP_002358035.1.1799 WP_002358035.1.18048 WP_002358035.1.18259 WP_002358035.1.18260 WP_002358035.1.18390 WP_002358035.1.18416 WP_002358035.1.18475 WP_002358035.1.18524 WP_002358035.1.18709 WP_002358035.1.19031 WP_002358035.1.19115 WP_002358035.1.19165 WP_002358035.1.1948 WP_002358035.1.19601 WP_002358035.1.19675 WP_002358035.1.19734 WP_002358035.1.19902 WP_002358035.1.19951 WP_002358035.1.20029 WP_002358035.1.20348 WP_002358035.1.20659 WP_002358035.1.2067 WP_002358035.1.20674 WP_002358035.1.2171 WP_002358035.1.21993 WP_002358035.1.22059 WP_002358035.1.2207 WP_002358035.1.22780 WP_002358035.1.22796 WP_002358035.1.23017 WP_002358035.1.23054 WP_002358035.1.23319 WP_002358035.1.23322 WP_002358035.1.23498 WP_002358035.1.23569 WP_002358035.1.23904 WP_002358035.1.24023 WP_002358035.1.24059 WP_002358035.1.24064 WP_002358035.1.24526 WP_002358035.1.24581 WP_002358035.1.246 WP_002358035.1.24743 WP_002358035.1.2486 WP_002358035.1.25180 WP_002358035.1.25583 WP_002358035.1.25669 WP_002358035.1.25702 WP_002358035.1.25704 WP_002358035.1.25979 WP_002358035.1.26187 WP_002358035.1.26451 WP_002358035.1.27081 WP_002358035.1.27216 WP_002358035.1.274 WP_002358035.1.2799 WP_002358035.1.2801 WP_002358035.1.28038 WP_002358035.1.28185 WP_002358035.1.28221 WP_002358035.1.28428 WP_002358035.1.28487 WP_002358035.1.28579 WP_002358035.1.28817 WP_002358035.1.28932 WP_002358035.1.28980 WP_002358035.1.29097 WP_002358035.1.29627 WP_002358035.1.29985 WP_002358035.1.3016 WP_002358035.1.30275 WP_002358035.1.30586 WP_002358035.1.30609 WP_002358035.1.31224 WP_002358035.1.31324 WP_002358035.1.31326 WP_002358035.1.31656 WP_002358035.1.31869 WP_002358035.1.32099 WP_002358035.1.321 WP_002358035.1.32265 WP_002358035.1.32385 WP_002358035.1.32500 WP_002358035.1.32914 WP_002358035.1.33139 WP_002358035.1.33306 WP_002358035.1.33460 WP_002358035.1.33513 WP_002358035.1.33531 WP_002358035.1.33574 WP_002358035.1.33581 WP_002358035.1.33685 WP_002358035.1.33798 WP_002358035.1.33851 WP_002358035.1.34192 WP_002358035.1.34256 WP_002358035.1.34766 WP_002358035.1.34947 WP_002358035.1.34999 WP_002358035.1.35171 WP_002358035.1.35283 WP_002358035.1.35449 WP_002358035.1.35810 WP_002358035.1.35823 WP_002358035.1.36198 WP_002358035.1.36209 WP_002358035.1.36269 WP_002358035.1.3645 WP_002358035.1.36880 WP_002358035.1.36900 WP_002358035.1.37031 WP_002358035.1.37181 WP_002358035.1.37810 WP_002358035.1.37850 WP_002358035.1.37885 WP_002358035.1.37996 WP_002358035.1.38725 WP_002358035.1.38784 WP_002358035.1.3909 WP_002358035.1.39119 WP_002358035.1.39771 WP_002358035.1.39932 WP_002358035.1.4014 WP_002358035.1.40357 WP_002358035.1.4071 WP_002358035.1.40757 WP_002358035.1.40908 WP_002358035.1.41053 WP_002358035.1.41792 WP_002358035.1.41867 WP_002358035.1.42239 WP_002358035.1.42353 WP_002358035.1.42483 WP_002358035.1.42904 WP_002358035.1.42908 WP_002358035.1.43540 WP_002358035.1.43903 WP_002358035.1.43994 WP_002358035.1.44185 WP_002358035.1.44242 WP_002358035.1.44501 WP_002358035.1.44537 WP_002358035.1.44626 WP_002358035.1.4487 WP_002358035.1.45269 WP_002358035.1.45484 WP_002358035.1.455 WP_002358035.1.4561 WP_002358035.1.45643 WP_002358035.1.45742 WP_002358035.1.45860 WP_002358035.1.45925 WP_002358035.1.46056 WP_002358035.1.46113 WP_002358035.1.46346 WP_002358035.1.46348 WP_002358035.1.46357 WP_002358035.1.46363 WP_002358035.1.46448 WP_002358035.1.46606 WP_002358035.1.46621 WP_002358035.1.47172 WP_002358035.1.47217 WP_002358035.1.47225 WP_002358035.1.47407 WP_002358035.1.47539 WP_002358035.1.47856 WP_002358035.1.47867 WP_002358035.1.48063 WP_002358035.1.48126 WP_002358035.1.48153 WP_002358035.1.48676 WP_002358035.1.49131 WP_002358035.1.49392 WP_002358035.1.49646 WP_002358035.1.4975 WP_002358035.1.49914 WP_002358035.1.49961 WP_002358035.1.50067 WP_002358035.1.50115 WP_002358035.1.50160 WP_002358035.1.50513 WP_002358035.1.50810 WP_002358035.1.5083 WP_002358035.1.50938 WP_002358035.1.51046 WP_002358035.1.5113 WP_002358035.1.51694 WP_002358035.1.51712 WP_002358035.1.52575 WP_002358035.1.52614 WP_002358035.1.52639 WP_002358035.1.52926 WP_002358035.1.53279 WP_002358035.1.53342 WP_002358035.1.53631 WP_002358035.1.53989 WP_002358035.1.53992 WP_002358035.1.54277 WP_002358035.1.54634 WP_002358035.1.54652 WP_002358035.1.54795 WP_002358035.1.54934 WP_002358035.1.54998 WP_002358035.1.55065 WP_002358035.1.56483 WP_002358035.1.5680 WP_002358035.1.56974 WP_002358035.1.57048 WP_002358035.1.57136 WP_002358035.1.57163 WP_002358035.1.57211 WP_002358035.1.57242 WP_002358035.1.57302 WP_002358035.1.57542 WP_002358035.1.57671 WP_002358035.1.57705 WP_002358035.1.57758 WP_002358035.1.57968 WP_002358035.1.58089 WP_002358035.1.58620 WP_002358035.1.5872 WP_002358035.1.58766 WP_002358035.1.59454 WP_002358035.1.59564 WP_002358035.1.59645 WP_002358035.1.59658 WP_002358035.1.59690 WP_002358035.1.59698 WP_002358035.1.5994 WP_002358035.1.59964 WP_002358035.1.60200 WP_002358035.1.60220 WP_002358035.1.60361 WP_002358035.1.60394 WP_002358035.1.60422 WP_002358035.1.60579 WP_002358035.1.60776 WP_002358035.1.60940 WP_002358035.1.61083 WP_002358035.1.61089 WP_002358035.1.61103 WP_002358035.1.61180 WP_002358035.1.61290 WP_002358035.1.61503 WP_002358035.1.6167 WP_002358035.1.61932 WP_002358035.1.62644 WP_002358035.1.62847 WP_002358035.1.62949 WP_002358035.1.6312 WP_002358035.1.63148 WP_002358035.1.63158 WP_002358035.1.63477 WP_002358035.1.63507 WP_002358035.1.63579 WP_002358035.1.63848 WP_002358035.1.63884 WP_002358035.1.64022 WP_002358035.1.64483 WP_002358035.1.6473 WP_002358035.1.65210 WP_002358035.1.65397 WP_002358035.1.65461 WP_002358035.1.65563 WP_002358035.1.6626 WP_002358035.1.66308 WP_002358035.1.66316 WP_002358035.1.66390 WP_002358035.1.66403 WP_002358035.1.66767 WP_002358035.1.6682 WP_002358035.1.66843 WP_002358035.1.66845 WP_002358035.1.66898 WP_002358035.1.66902 WP_002358035.1.67436 WP_002358035.1.67615 WP_002358035.1.67683 WP_002358035.1.67716 WP_002358035.1.68409 WP_002358035.1.68746 WP_002358035.1.68828 WP_002358035.1.6893 WP_002358035.1.68935 WP_002358035.1.69290 WP_002358035.1.69336 WP_002358035.1.69521 WP_002358035.1.69648 WP_002358035.1.69824 WP_002358035.1.70043 WP_002358035.1.70675 WP_002358035.1.70756 WP_002358035.1.70799 WP_002358035.1.7118 WP_002358035.1.71303 WP_002358035.1.71406 WP_002358035.1.71499 WP_002358035.1.71510 WP_002358035.1.71725 WP_002358035.1.72058 WP_002358035.1.72077 WP_002358035.1.72635 WP_002358035.1.72733 WP_002358035.1.73695 WP_002358035.1.73817 WP_002358035.1.73824 WP_002358035.1.74362 WP_002358035.1.74389 WP_002358035.1.74591 WP_002358035.1.75211 WP_002358035.1.75297 WP_002358035.1.75486 WP_002358035.1.75949 WP_002358035.1.76074 WP_002358035.1.76128 WP_002358035.1.76541 WP_002358035.1.76646 WP_002358035.1.76958 WP_002358035.1.77302 WP_002358035.1.77327 WP_002358035.1.77328 WP_002358035.1.77357 WP_002358035.1.77956 WP_002358035.1.7815 WP_002358035.1.7819 WP_002358035.1.78447 WP_002358035.1.78471 WP_002358035.1.78503 WP_002358035.1.78587 WP_002358035.1.78641 WP_002358035.1.79457 WP_002358035.1.7958 WP_002358035.1.79791 WP_002358035.1.79975 WP_002358035.1.80104 WP_002358035.1.80396 WP_002358035.1.80452 WP_002358035.1.80556 WP_002358035.1.8058 WP_002358035.1.80867 WP_002358035.1.80889 WP_002358035.1.80976 WP_002358035.1.81312 WP_002358035.1.81327 WP_002358035.1.81459 WP_002358035.1.81575 WP_002358035.1.8179 WP_002358035.1.81880 WP_002358035.1.81991 WP_002358035.1.82160 WP_002358035.1.82202 WP_002358035.1.82555 WP_002358035.1.82993 WP_002358035.1.83032 WP_002358035.1.83327 WP_002358035.1.83490 WP_002358035.1.83649 WP_002358035.1.8380 WP_002358035.1.83953 WP_002358035.1.84260 WP_002358035.1.84380 WP_002358035.1.84469 WP_002358035.1.84573 WP_002358035.1.84632 WP_002358035.1.84813 WP_002358035.1.85162 WP_002358035.1.85355 WP_002358035.1.85465 WP_002358035.1.85534 WP_002358035.1.8575 WP_002358035.1.85848 WP_002358035.1.85862 WP_002358035.1.85945 WP_002358035.1.85963 WP_002358035.1.86134 WP_002358035.1.86666 WP_002358035.1.86904 WP_002358035.1.87000 WP_002358035.1.87252 WP_002358035.1.87277 WP_002358035.1.87385 WP_002358035.1.87482 WP_002358035.1.87855 WP_002358035.1.8794 WP_002358035.1.88329 WP_002358035.1.88464 WP_002358035.1.88661 WP_002358035.1.8901 WP_002358035.1.89060 WP_002358035.1.89088 WP_002358035.1.89321 WP_002358035.1.89431 WP_002358035.1.8960 WP_002358035.1.89791 WP_002358035.1.90047 WP_002358035.1.90100 WP_002358035.1.90371 WP_002358035.1.90503 WP_002358035.1.90642 WP_002358035.1.90872 WP_002358035.1.91092 WP_002358035.1.91394 WP_002358035.1.91555 WP_002358035.1.9159 WP_002358035.1.91608 WP_002358035.1.91813 WP_002358035.1.91925 WP_002358035.1.92037 WP_002358035.1.92073 WP_002358035.1.9214 WP_002358035.1.92348 WP_002358035.1.92581 WP_002358035.1.92820 WP_002358035.1.93159 WP_002358035.1.93277 WP_002358035.1.93642 WP_002358035.1.93977 WP_002358035.1.94041 WP_002358035.1.94399 WP_002358035.1.94506 WP_002358035.1.94612 WP_002358035.1.94630 WP_002358035.1.94964 WP_002358035.1.95143 WP_002358035.1.95212 WP_002358035.1.95228 WP_002358035.1.95340 WP_002358035.1.95445 WP_002358035.1.95493 WP_002358035.1.95534 WP_002358035.1.95629 WP_002358035.1.9570 WP_002358035.1.95935 WP_002358035.1.95970 WP_002358035.1.95971 WP_002358035.1.96320 WP_002358035.1.96467 WP_002358035.1.96481 WP_002358035.1.96745 WP_002358035.1.96764 WP_002358035.1.96987 WP_002358035.1.97078 WP_002358035.1.97268 WP_002358035.1.97643 WP_002358035.1.97828 WP_002358035.1.98078 WP_002358035.1.98122 WP_002358035.1.9842 WP_002358035.1.98652 WP_002358035.1.98840 WP_002358035.1.98868 WP_002358035.1.99 WP_002358035.1.99014 WP_002358035.1.99022 WP_002358035.1.9925 WP_002358035.1.99432 WP_002358035.1.99543 WP_002358035.1.99748 gi|384512856|ref|YP_005707949.1| gi|479179887|ref|YP_007807196.1| gi|428766623|ref|YP_007152734.1| 226185.EF1114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]