SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384513031|ref|YP_005708124.1| from Enterococcus faecalis OG1RF

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384513031|ref|YP_005708124.1|
Domain Number 1 Region: 5-101
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.27e-22
Family PadR-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384513031|ref|YP_005708124.1|
Sequence length 107
Comment PadR family transcriptional regulator [Enterococcus faecalis OG1RF]
Sequence
MKQTELLKGILEGLVLAIIQRKETYGYEITKILNDQGFTEIVEGTVYTILLRLEKNQWVI
AEKKPSEKGPMRKFYRLTSSGEAELADFWQRWTLLSKQVNKMKKMEG
Download sequence
Identical sequences A0A0E9EVE1 A0A0H1U3S7 A0A0M2ABD1 A0A0M2ASY4 A0A0M2CMC3 A0A0Y4HX77 A0A125W1U8 A0A1B4XN79 A0A1R4JSM0 C7VC56 C7X2F7 D4EKH4 D4EU01 E0HD98 E2YBM8 E2YLY5 E2YWS0 E6EXA6 E6GGP3 E6IG31 R3I9C5 S4F1T5 S4F9X6 U6S0Y4 V7ZNC0 X5NXF2
gi|397699677|ref|YP_006537465.1| gi|384518394|ref|YP_005705699.1| gi|384513031|ref|YP_005708124.1| WP_002357837.1.61180 gi|428766796|ref|YP_007152907.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]