SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384513209|ref|YP_005708302.1| from Enterococcus faecalis OG1RF

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384513209|ref|YP_005708302.1|
Domain Number 1 Region: 9-143
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.14e-35
Family FUR-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384513209|ref|YP_005708302.1|
Sequence length 149
Comment ferric uptake regulation protein [Enterococcus faecalis OG1RF]
Sequence
MDSTAALKKTKKQLHESGFKLTPQREATVLVLLENEKDHLSAEEIYFLVKQKSPEIGLAT
VYRTLEILTDLKVVDKVSFNDGLARYDLRKEGAKHFHHHLLCLECGTIEEVEEDLLGEVE
QIVESRYHFLVKDHRLTFHGICQSCQSKH
Download sequence
Identical sequences A0A059N613 A0A0E9F2F6 A0A0H1U1Q7 A0A0M2AAL6 A0A0M2ATL1 A0A0M2CM35 A0A0U1AD69 A0A0Y4BI31 A0A0Y7G4G1 A0A125W1C8 A0A1B4XNP5 A0A1R4L268 C0X5B5 C7D3N5 C7VCK7 D4EQA6 D4ETP6 E0HFD4 E2YCA0 E2YMK8 E2YV47 E6EZG1 E6GH61 E6GXN0 E6H121 J5GBD0 J5GIC6 J5K533 J6A1A2 J6DWH0 J6EUE0 J6FAK1 J6LLN7 J6NJR1 J6P053 J6P1G5 J6PSA0 J6QGV0 J6QLN8 J6QWC8 Q834V6 R3I8U9 R3JA03 S4C1J5 U6S2U7 V7ZNK4
gi|479180151|ref|YP_007807460.1| gi|428766963|ref|YP_007153074.1| gi|29376090|ref|NP_815244.1| NP_815244.1.90627 WP_002357640.1.100343 WP_002357640.1.100390 WP_002357640.1.100482 WP_002357640.1.101272 WP_002357640.1.101275 WP_002357640.1.101479 WP_002357640.1.101808 WP_002357640.1.101818 WP_002357640.1.101914 WP_002357640.1.10330 WP_002357640.1.10696 WP_002357640.1.10758 WP_002357640.1.11193 WP_002357640.1.11284 WP_002357640.1.11459 WP_002357640.1.11651 WP_002357640.1.12145 WP_002357640.1.12449 WP_002357640.1.12625 WP_002357640.1.12630 WP_002357640.1.12825 WP_002357640.1.12889 WP_002357640.1.1291 WP_002357640.1.12926 WP_002357640.1.13021 WP_002357640.1.13365 WP_002357640.1.13369 WP_002357640.1.1344 WP_002357640.1.13739 WP_002357640.1.14157 WP_002357640.1.14180 WP_002357640.1.14269 WP_002357640.1.14402 WP_002357640.1.14420 WP_002357640.1.14750 WP_002357640.1.14792 WP_002357640.1.15543 WP_002357640.1.15705 WP_002357640.1.16241 WP_002357640.1.16763 WP_002357640.1.17164 WP_002357640.1.17287 WP_002357640.1.17682 WP_002357640.1.17799 WP_002357640.1.1799 WP_002357640.1.18048 WP_002357640.1.18259 WP_002357640.1.18260 WP_002357640.1.18390 WP_002357640.1.18416 WP_002357640.1.18475 WP_002357640.1.18709 WP_002357640.1.19031 WP_002357640.1.19115 WP_002357640.1.19165 WP_002357640.1.1948 WP_002357640.1.19601 WP_002357640.1.19675 WP_002357640.1.19734 WP_002357640.1.19902 WP_002357640.1.19951 WP_002357640.1.20348 WP_002357640.1.20659 WP_002357640.1.2067 WP_002357640.1.20674 WP_002357640.1.2171 WP_002357640.1.21993 WP_002357640.1.22059 WP_002357640.1.2207 WP_002357640.1.22796 WP_002357640.1.23017 WP_002357640.1.23054 WP_002357640.1.23319 WP_002357640.1.23322 WP_002357640.1.23498 WP_002357640.1.23569 WP_002357640.1.23904 WP_002357640.1.24023 WP_002357640.1.24059 WP_002357640.1.24064 WP_002357640.1.24526 WP_002357640.1.24581 WP_002357640.1.246 WP_002357640.1.24743 WP_002357640.1.2486 WP_002357640.1.25180 WP_002357640.1.25583 WP_002357640.1.25669 WP_002357640.1.25702 WP_002357640.1.25704 WP_002357640.1.25979 WP_002357640.1.26187 WP_002357640.1.26451 WP_002357640.1.27081 WP_002357640.1.27216 WP_002357640.1.274 WP_002357640.1.2799 WP_002357640.1.2801 WP_002357640.1.28185 WP_002357640.1.28428 WP_002357640.1.28487 WP_002357640.1.28817 WP_002357640.1.28932 WP_002357640.1.28980 WP_002357640.1.29097 WP_002357640.1.29627 WP_002357640.1.29985 WP_002357640.1.3016 WP_002357640.1.30275 WP_002357640.1.30586 WP_002357640.1.30609 WP_002357640.1.31224 WP_002357640.1.31324 WP_002357640.1.31326 WP_002357640.1.31656 WP_002357640.1.32099 WP_002357640.1.321 WP_002357640.1.32265 WP_002357640.1.32385 WP_002357640.1.32500 WP_002357640.1.32914 WP_002357640.1.33139 WP_002357640.1.33306 WP_002357640.1.33460 WP_002357640.1.33513 WP_002357640.1.33531 WP_002357640.1.33574 WP_002357640.1.33581 WP_002357640.1.33685 WP_002357640.1.33798 WP_002357640.1.33851 WP_002357640.1.34192 WP_002357640.1.34256 WP_002357640.1.34766 WP_002357640.1.34947 WP_002357640.1.34999 WP_002357640.1.35171 WP_002357640.1.35449 WP_002357640.1.35810 WP_002357640.1.35823 WP_002357640.1.36198 WP_002357640.1.36209 WP_002357640.1.36269 WP_002357640.1.3645 WP_002357640.1.36880 WP_002357640.1.36900 WP_002357640.1.37031 WP_002357640.1.37181 WP_002357640.1.37810 WP_002357640.1.37850 WP_002357640.1.37885 WP_002357640.1.37996 WP_002357640.1.38725 WP_002357640.1.38784 WP_002357640.1.3909 WP_002357640.1.39119 WP_002357640.1.39771 WP_002357640.1.39932 WP_002357640.1.4014 WP_002357640.1.40357 WP_002357640.1.4071 WP_002357640.1.40757 WP_002357640.1.40908 WP_002357640.1.41053 WP_002357640.1.41792 WP_002357640.1.41867 WP_002357640.1.42239 WP_002357640.1.42353 WP_002357640.1.42483 WP_002357640.1.42904 WP_002357640.1.42908 WP_002357640.1.43540 WP_002357640.1.43903 WP_002357640.1.43994 WP_002357640.1.44185 WP_002357640.1.44242 WP_002357640.1.44501 WP_002357640.1.44537 WP_002357640.1.44626 WP_002357640.1.4487 WP_002357640.1.45269 WP_002357640.1.45484 WP_002357640.1.455 WP_002357640.1.4561 WP_002357640.1.45643 WP_002357640.1.45742 WP_002357640.1.45860 WP_002357640.1.45925 WP_002357640.1.46056 WP_002357640.1.46113 WP_002357640.1.46348 WP_002357640.1.46357 WP_002357640.1.46363 WP_002357640.1.46448 WP_002357640.1.46606 WP_002357640.1.46621 WP_002357640.1.47172 WP_002357640.1.47217 WP_002357640.1.47225 WP_002357640.1.47407 WP_002357640.1.47539 WP_002357640.1.47856 WP_002357640.1.47867 WP_002357640.1.48063 WP_002357640.1.48153 WP_002357640.1.48676 WP_002357640.1.49131 WP_002357640.1.49392 WP_002357640.1.49646 WP_002357640.1.49914 WP_002357640.1.49961 WP_002357640.1.50067 WP_002357640.1.50115 WP_002357640.1.50160 WP_002357640.1.50513 WP_002357640.1.50810 WP_002357640.1.5083 WP_002357640.1.50938 WP_002357640.1.51046 WP_002357640.1.5113 WP_002357640.1.51694 WP_002357640.1.51712 WP_002357640.1.52575 WP_002357640.1.52614 WP_002357640.1.52639 WP_002357640.1.52926 WP_002357640.1.53279 WP_002357640.1.53342 WP_002357640.1.53631 WP_002357640.1.53989 WP_002357640.1.53992 WP_002357640.1.54277 WP_002357640.1.54634 WP_002357640.1.54652 WP_002357640.1.54795 WP_002357640.1.54934 WP_002357640.1.55065 WP_002357640.1.56483 WP_002357640.1.5680 WP_002357640.1.56974 WP_002357640.1.57048 WP_002357640.1.57136 WP_002357640.1.57163 WP_002357640.1.57211 WP_002357640.1.57242 WP_002357640.1.57302 WP_002357640.1.57542 WP_002357640.1.57671 WP_002357640.1.57705 WP_002357640.1.57758 WP_002357640.1.57968 WP_002357640.1.58620 WP_002357640.1.5872 WP_002357640.1.58766 WP_002357640.1.59454 WP_002357640.1.59564 WP_002357640.1.59645 WP_002357640.1.59658 WP_002357640.1.59690 WP_002357640.1.59698 WP_002357640.1.5994 WP_002357640.1.59964 WP_002357640.1.60200 WP_002357640.1.60220 WP_002357640.1.60361 WP_002357640.1.60394 WP_002357640.1.60422 WP_002357640.1.60579 WP_002357640.1.60776 WP_002357640.1.60940 WP_002357640.1.61083 WP_002357640.1.61089 WP_002357640.1.61103 WP_002357640.1.61180 WP_002357640.1.61290 WP_002357640.1.61503 WP_002357640.1.6167 WP_002357640.1.61932 WP_002357640.1.62644 WP_002357640.1.62847 WP_002357640.1.62949 WP_002357640.1.6312 WP_002357640.1.63148 WP_002357640.1.63477 WP_002357640.1.63507 WP_002357640.1.63579 WP_002357640.1.63848 WP_002357640.1.63884 WP_002357640.1.64022 WP_002357640.1.64483 WP_002357640.1.6473 WP_002357640.1.65210 WP_002357640.1.65397 WP_002357640.1.65563 WP_002357640.1.6626 WP_002357640.1.66308 WP_002357640.1.66316 WP_002357640.1.66390 WP_002357640.1.66403 WP_002357640.1.66767 WP_002357640.1.6682 WP_002357640.1.66843 WP_002357640.1.66845 WP_002357640.1.66898 WP_002357640.1.66902 WP_002357640.1.67436 WP_002357640.1.67615 WP_002357640.1.67683 WP_002357640.1.67716 WP_002357640.1.68409 WP_002357640.1.68746 WP_002357640.1.68828 WP_002357640.1.6893 WP_002357640.1.68935 WP_002357640.1.69290 WP_002357640.1.69336 WP_002357640.1.69521 WP_002357640.1.69648 WP_002357640.1.69824 WP_002357640.1.70043 WP_002357640.1.70675 WP_002357640.1.70756 WP_002357640.1.70799 WP_002357640.1.7118 WP_002357640.1.71303 WP_002357640.1.71406 WP_002357640.1.71499 WP_002357640.1.71510 WP_002357640.1.71725 WP_002357640.1.72077 WP_002357640.1.72635 WP_002357640.1.73695 WP_002357640.1.73817 WP_002357640.1.73824 WP_002357640.1.74389 WP_002357640.1.74591 WP_002357640.1.75211 WP_002357640.1.75297 WP_002357640.1.75486 WP_002357640.1.75949 WP_002357640.1.76074 WP_002357640.1.76128 WP_002357640.1.76646 WP_002357640.1.76958 WP_002357640.1.77327 WP_002357640.1.77328 WP_002357640.1.77357 WP_002357640.1.77956 WP_002357640.1.7815 WP_002357640.1.7819 WP_002357640.1.78447 WP_002357640.1.78471 WP_002357640.1.78503 WP_002357640.1.78587 WP_002357640.1.78641 WP_002357640.1.79457 WP_002357640.1.7958 WP_002357640.1.79791 WP_002357640.1.79975 WP_002357640.1.80104 WP_002357640.1.80396 WP_002357640.1.80452 WP_002357640.1.80556 WP_002357640.1.8058 WP_002357640.1.80889 WP_002357640.1.80976 WP_002357640.1.81312 WP_002357640.1.81327 WP_002357640.1.81459 WP_002357640.1.81575 WP_002357640.1.8179 WP_002357640.1.81880 WP_002357640.1.81991 WP_002357640.1.82160 WP_002357640.1.82202 WP_002357640.1.82555 WP_002357640.1.82993 WP_002357640.1.83032 WP_002357640.1.83327 WP_002357640.1.83490 WP_002357640.1.83649 WP_002357640.1.8380 WP_002357640.1.83953 WP_002357640.1.84260 WP_002357640.1.84380 WP_002357640.1.84469 WP_002357640.1.84632 WP_002357640.1.84813 WP_002357640.1.85162 WP_002357640.1.85355 WP_002357640.1.85465 WP_002357640.1.85534 WP_002357640.1.8575 WP_002357640.1.85848 WP_002357640.1.85862 WP_002357640.1.85945 WP_002357640.1.85963 WP_002357640.1.86134 WP_002357640.1.86666 WP_002357640.1.86904 WP_002357640.1.87000 WP_002357640.1.87252 WP_002357640.1.87277 WP_002357640.1.87385 WP_002357640.1.87482 WP_002357640.1.87855 WP_002357640.1.8794 WP_002357640.1.88329 WP_002357640.1.88464 WP_002357640.1.88661 WP_002357640.1.8901 WP_002357640.1.89060 WP_002357640.1.89088 WP_002357640.1.89321 WP_002357640.1.89431 WP_002357640.1.8960 WP_002357640.1.89791 WP_002357640.1.90047 WP_002357640.1.90100 WP_002357640.1.90371 WP_002357640.1.90503 WP_002357640.1.90642 WP_002357640.1.90872 WP_002357640.1.91092 WP_002357640.1.91394 WP_002357640.1.91555 WP_002357640.1.9159 WP_002357640.1.91608 WP_002357640.1.91813 WP_002357640.1.91925 WP_002357640.1.92037 WP_002357640.1.92073 WP_002357640.1.9214 WP_002357640.1.92348 WP_002357640.1.92581 WP_002357640.1.93159 WP_002357640.1.93277 WP_002357640.1.93642 WP_002357640.1.94041 WP_002357640.1.94399 WP_002357640.1.94506 WP_002357640.1.94612 WP_002357640.1.94630 WP_002357640.1.95143 WP_002357640.1.95212 WP_002357640.1.95228 WP_002357640.1.95445 WP_002357640.1.95493 WP_002357640.1.95534 WP_002357640.1.95629 WP_002357640.1.9570 WP_002357640.1.95935 WP_002357640.1.95971 WP_002357640.1.96320 WP_002357640.1.96481 WP_002357640.1.96745 WP_002357640.1.96764 WP_002357640.1.96987 WP_002357640.1.97078 WP_002357640.1.97268 WP_002357640.1.97643 WP_002357640.1.97828 WP_002357640.1.98078 WP_002357640.1.98122 WP_002357640.1.9842 WP_002357640.1.98652 WP_002357640.1.98840 WP_002357640.1.98868 WP_002357640.1.99 WP_002357640.1.99014 WP_002357640.1.99022 WP_002357640.1.9925 WP_002357640.1.99432 WP_002357640.1.99543 gi|397699848|ref|YP_006537636.1| gi|384513209|ref|YP_005708302.1| gi|384518557|ref|YP_005705862.1| 226185.EF1525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]