SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384513813|ref|YP_005708906.1| from Enterococcus faecalis OG1RF

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384513813|ref|YP_005708906.1|
Domain Number 1 Region: 11-142
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.95e-32
Family FUR-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384513813|ref|YP_005708906.1|
Sequence length 146
Comment Fur family transcriptional regulator ZurR [Enterococcus faecalis OG1RF]
Sequence
MAMAPVKTNIEQALETMKASGLKYTKKRELLMSYLIKRNRYVSAREVYEFMNETFKGVSY
DTVYRNLHDFERLELLEKTELNGEQKFRFRCCQEVEHHHHFICTVCGKTEEIHMCPMNFF
EEQLKGCSIEGHRFEILGRCADCCEK
Download sequence
Identical sequences A0A0H1U3G0 A0A1J6XQ69 D4EJD7 E2YZR6 E6GYI1 J5ECN0 J5EGE3 J5HI74 J6BNW2 J6H438 J6M1V7 J6PC20 J6Q3R4 J6R074 J6R888 S4EWI9
gi|384513813|ref|YP_005708906.1| WP_002387080.1.61180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]