SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384513917|ref|YP_005709010.1| from Enterococcus faecalis OG1RF

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384513917|ref|YP_005709010.1|
Domain Number 1 Region: 11-103
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.67e-20
Family N-terminal domain of molybdate-dependent transcriptional regulator ModE 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384513917|ref|YP_005709010.1|
Sequence length 119
Comment molybdenum transport domain protein [Enterococcus faecalis OG1RF]
Sequence
MFTYSLNLKLKTDRNFFGPGVVEVLQKIQQTGSLNLAAKEMKMSYNKAWRIVRVAEEELS
FPLIIKSVGGCNGGGSIVTDQGKELIDQYLLFEKKVYQQVEACFEEIFKEQDVVSEELK
Download sequence
Identical sequences A0A059MZQ0 A0A0E9EXY4 A0A0H1TQJ1 A0A0M2AA28 A0A0M2CIT4 A0A0U1AZE4 A0A0Y4CNN7 A0A112VC33 A0A125W2W9 A0A1B4XQR6 A0A1R4KTE3 C0X891 C7VAV7 C7WZT3 D4EID4 D4EWS6 E2YP70 E2YS05 E6EUY3 E6GKA8 E6GW62 E6H4D7 J5E1L0 J6B4J3 J6BM04 J6CBG9 J6CF04 J6E0X3 J6EJX8 J6EUG4 J6FB34 J6FEI8 J6M8G6 J6NLS7 J6PGJ3 J6PWF0 J6RJ56 Q831D9 R3GT95 R3KS87 S4CDQ9 S4F8S8 S4FS60 U6S441 V7ZU56 X5NVT1
226185.EF2572 APC29465 gi|384519378|ref|YP_005706683.1| gi|428767731|ref|YP_007153842.1| gi|397700712|ref|YP_006538500.1| gi|384513917|ref|YP_005709010.1| NP_816213.1.90627 WP_002356595.1.100343 WP_002356595.1.100390 WP_002356595.1.100415 WP_002356595.1.10042 WP_002356595.1.100482 WP_002356595.1.101272 WP_002356595.1.101479 WP_002356595.1.101808 WP_002356595.1.101818 WP_002356595.1.101914 WP_002356595.1.102128 WP_002356595.1.10330 WP_002356595.1.10696 WP_002356595.1.10758 WP_002356595.1.11048 WP_002356595.1.11193 WP_002356595.1.11284 WP_002356595.1.11459 WP_002356595.1.11651 WP_002356595.1.12145 WP_002356595.1.12247 WP_002356595.1.12625 WP_002356595.1.12630 WP_002356595.1.12825 WP_002356595.1.12889 WP_002356595.1.1291 WP_002356595.1.12926 WP_002356595.1.13021 WP_002356595.1.13365 WP_002356595.1.13369 WP_002356595.1.1344 WP_002356595.1.13739 WP_002356595.1.14157 WP_002356595.1.14180 WP_002356595.1.14269 WP_002356595.1.14402 WP_002356595.1.14420 WP_002356595.1.14485 WP_002356595.1.14750 WP_002356595.1.14792 WP_002356595.1.15224 WP_002356595.1.15286 WP_002356595.1.15458 WP_002356595.1.15543 WP_002356595.1.15705 WP_002356595.1.1595 WP_002356595.1.16241 WP_002356595.1.16763 WP_002356595.1.17164 WP_002356595.1.17287 WP_002356595.1.17682 WP_002356595.1.17799 WP_002356595.1.17800 WP_002356595.1.1799 WP_002356595.1.18048 WP_002356595.1.18259 WP_002356595.1.18260 WP_002356595.1.18390 WP_002356595.1.18416 WP_002356595.1.18475 WP_002356595.1.18709 WP_002356595.1.19031 WP_002356595.1.19115 WP_002356595.1.1948 WP_002356595.1.19601 WP_002356595.1.19675 WP_002356595.1.19734 WP_002356595.1.19902 WP_002356595.1.19951 WP_002356595.1.20029 WP_002356595.1.20348 WP_002356595.1.20659 WP_002356595.1.2067 WP_002356595.1.20674 WP_002356595.1.2171 WP_002356595.1.21993 WP_002356595.1.22059 WP_002356595.1.2207 WP_002356595.1.22780 WP_002356595.1.22796 WP_002356595.1.23017 WP_002356595.1.23054 WP_002356595.1.23319 WP_002356595.1.23322 WP_002356595.1.23498 WP_002356595.1.23569 WP_002356595.1.23904 WP_002356595.1.24023 WP_002356595.1.24059 WP_002356595.1.24064 WP_002356595.1.24526 WP_002356595.1.24581 WP_002356595.1.246 WP_002356595.1.2486 WP_002356595.1.25180 WP_002356595.1.25583 WP_002356595.1.25669 WP_002356595.1.25702 WP_002356595.1.25704 WP_002356595.1.25979 WP_002356595.1.26187 WP_002356595.1.26451 WP_002356595.1.27081 WP_002356595.1.274 WP_002356595.1.2799 WP_002356595.1.2801 WP_002356595.1.28038 WP_002356595.1.28185 WP_002356595.1.28221 WP_002356595.1.28428 WP_002356595.1.28487 WP_002356595.1.28579 WP_002356595.1.28817 WP_002356595.1.28932 WP_002356595.1.28980 WP_002356595.1.29097 WP_002356595.1.29627 WP_002356595.1.29985 WP_002356595.1.3016 WP_002356595.1.30586 WP_002356595.1.30609 WP_002356595.1.31224 WP_002356595.1.31324 WP_002356595.1.31326 WP_002356595.1.31656 WP_002356595.1.31869 WP_002356595.1.32099 WP_002356595.1.321 WP_002356595.1.32265 WP_002356595.1.32385 WP_002356595.1.32500 WP_002356595.1.32914 WP_002356595.1.33139 WP_002356595.1.33306 WP_002356595.1.33460 WP_002356595.1.33513 WP_002356595.1.33531 WP_002356595.1.33574 WP_002356595.1.33581 WP_002356595.1.33685 WP_002356595.1.33798 WP_002356595.1.33851 WP_002356595.1.34192 WP_002356595.1.34256 WP_002356595.1.34766 WP_002356595.1.34947 WP_002356595.1.35171 WP_002356595.1.35283 WP_002356595.1.35449 WP_002356595.1.35810 WP_002356595.1.35823 WP_002356595.1.36198 WP_002356595.1.36209 WP_002356595.1.36269 WP_002356595.1.3645 WP_002356595.1.36880 WP_002356595.1.36900 WP_002356595.1.37031 WP_002356595.1.37181 WP_002356595.1.37810 WP_002356595.1.37850 WP_002356595.1.37885 WP_002356595.1.37996 WP_002356595.1.38725 WP_002356595.1.38784 WP_002356595.1.3909 WP_002356595.1.39119 WP_002356595.1.39771 WP_002356595.1.39932 WP_002356595.1.4014 WP_002356595.1.40357 WP_002356595.1.4071 WP_002356595.1.40757 WP_002356595.1.40908 WP_002356595.1.41053 WP_002356595.1.41792 WP_002356595.1.41867 WP_002356595.1.42239 WP_002356595.1.42353 WP_002356595.1.42483 WP_002356595.1.42904 WP_002356595.1.42908 WP_002356595.1.43540 WP_002356595.1.43903 WP_002356595.1.43994 WP_002356595.1.44185 WP_002356595.1.44242 WP_002356595.1.44501 WP_002356595.1.44537 WP_002356595.1.44626 WP_002356595.1.4487 WP_002356595.1.45269 WP_002356595.1.45484 WP_002356595.1.455 WP_002356595.1.4561 WP_002356595.1.45643 WP_002356595.1.45742 WP_002356595.1.45860 WP_002356595.1.45925 WP_002356595.1.46056 WP_002356595.1.46113 WP_002356595.1.46346 WP_002356595.1.46348 WP_002356595.1.46357 WP_002356595.1.46363 WP_002356595.1.46606 WP_002356595.1.46621 WP_002356595.1.47217 WP_002356595.1.47225 WP_002356595.1.47407 WP_002356595.1.47539 WP_002356595.1.47856 WP_002356595.1.47867 WP_002356595.1.48063 WP_002356595.1.48126 WP_002356595.1.48153 WP_002356595.1.48676 WP_002356595.1.49131 WP_002356595.1.49646 WP_002356595.1.4975 WP_002356595.1.49914 WP_002356595.1.49961 WP_002356595.1.50067 WP_002356595.1.50115 WP_002356595.1.50513 WP_002356595.1.50810 WP_002356595.1.5083 WP_002356595.1.50938 WP_002356595.1.51046 WP_002356595.1.5113 WP_002356595.1.51694 WP_002356595.1.51712 WP_002356595.1.52575 WP_002356595.1.52614 WP_002356595.1.52639 WP_002356595.1.52926 WP_002356595.1.53279 WP_002356595.1.53342 WP_002356595.1.53631 WP_002356595.1.53989 WP_002356595.1.53992 WP_002356595.1.54277 WP_002356595.1.54634 WP_002356595.1.54652 WP_002356595.1.54795 WP_002356595.1.54934 WP_002356595.1.54998 WP_002356595.1.55065 WP_002356595.1.56483 WP_002356595.1.5680 WP_002356595.1.56974 WP_002356595.1.57048 WP_002356595.1.57136 WP_002356595.1.57163 WP_002356595.1.57211 WP_002356595.1.57242 WP_002356595.1.57302 WP_002356595.1.57542 WP_002356595.1.57671 WP_002356595.1.57705 WP_002356595.1.57758 WP_002356595.1.57968 WP_002356595.1.58089 WP_002356595.1.58620 WP_002356595.1.5872 WP_002356595.1.58766 WP_002356595.1.59454 WP_002356595.1.59564 WP_002356595.1.59645 WP_002356595.1.59658 WP_002356595.1.59690 WP_002356595.1.59698 WP_002356595.1.5994 WP_002356595.1.59964 WP_002356595.1.60200 WP_002356595.1.60361 WP_002356595.1.60394 WP_002356595.1.60422 WP_002356595.1.60579 WP_002356595.1.60940 WP_002356595.1.61083 WP_002356595.1.61089 WP_002356595.1.61103 WP_002356595.1.61180 WP_002356595.1.61290 WP_002356595.1.6167 WP_002356595.1.61932 WP_002356595.1.62644 WP_002356595.1.62847 WP_002356595.1.62949 WP_002356595.1.6312 WP_002356595.1.63148 WP_002356595.1.63158 WP_002356595.1.63477 WP_002356595.1.63507 WP_002356595.1.63848 WP_002356595.1.63884 WP_002356595.1.64022 WP_002356595.1.64483 WP_002356595.1.6473 WP_002356595.1.65210 WP_002356595.1.65397 WP_002356595.1.65461 WP_002356595.1.65563 WP_002356595.1.6626 WP_002356595.1.66308 WP_002356595.1.66316 WP_002356595.1.66390 WP_002356595.1.66403 WP_002356595.1.66767 WP_002356595.1.6682 WP_002356595.1.66843 WP_002356595.1.66845 WP_002356595.1.66898 WP_002356595.1.66902 WP_002356595.1.67436 WP_002356595.1.67615 WP_002356595.1.67683 WP_002356595.1.67716 WP_002356595.1.68409 WP_002356595.1.68746 WP_002356595.1.6893 WP_002356595.1.68935 WP_002356595.1.69290 WP_002356595.1.69336 WP_002356595.1.69521 WP_002356595.1.69648 WP_002356595.1.69824 WP_002356595.1.70043 WP_002356595.1.70675 WP_002356595.1.70756 WP_002356595.1.70799 WP_002356595.1.7118 WP_002356595.1.71303 WP_002356595.1.71406 WP_002356595.1.71499 WP_002356595.1.71510 WP_002356595.1.71725 WP_002356595.1.72058 WP_002356595.1.72077 WP_002356595.1.72635 WP_002356595.1.72733 WP_002356595.1.73695 WP_002356595.1.73817 WP_002356595.1.73824 WP_002356595.1.74362 WP_002356595.1.74389 WP_002356595.1.74591 WP_002356595.1.75211 WP_002356595.1.75297 WP_002356595.1.75486 WP_002356595.1.75949 WP_002356595.1.76074 WP_002356595.1.76128 WP_002356595.1.76541 WP_002356595.1.76646 WP_002356595.1.76958 WP_002356595.1.77302 WP_002356595.1.77327 WP_002356595.1.77328 WP_002356595.1.77357 WP_002356595.1.77956 WP_002356595.1.7815 WP_002356595.1.7819 WP_002356595.1.78447 WP_002356595.1.78471 WP_002356595.1.78503 WP_002356595.1.78587 WP_002356595.1.78641 WP_002356595.1.79457 WP_002356595.1.7958 WP_002356595.1.79791 WP_002356595.1.79975 WP_002356595.1.80104 WP_002356595.1.80396 WP_002356595.1.80452 WP_002356595.1.80556 WP_002356595.1.8058 WP_002356595.1.80889 WP_002356595.1.80976 WP_002356595.1.81312 WP_002356595.1.81327 WP_002356595.1.81459 WP_002356595.1.81575 WP_002356595.1.8179 WP_002356595.1.81880 WP_002356595.1.81991 WP_002356595.1.82160 WP_002356595.1.82202 WP_002356595.1.82555 WP_002356595.1.82993 WP_002356595.1.83032 WP_002356595.1.83327 WP_002356595.1.83490 WP_002356595.1.8380 WP_002356595.1.83953 WP_002356595.1.84260 WP_002356595.1.84380 WP_002356595.1.84469 WP_002356595.1.84573 WP_002356595.1.84632 WP_002356595.1.84813 WP_002356595.1.85162 WP_002356595.1.85355 WP_002356595.1.85534 WP_002356595.1.8575 WP_002356595.1.85848 WP_002356595.1.85862 WP_002356595.1.85945 WP_002356595.1.85963 WP_002356595.1.86134 WP_002356595.1.86666 WP_002356595.1.86904 WP_002356595.1.87000 WP_002356595.1.87252 WP_002356595.1.87277 WP_002356595.1.87385 WP_002356595.1.87482 WP_002356595.1.87855 WP_002356595.1.8794 WP_002356595.1.88329 WP_002356595.1.88464 WP_002356595.1.88661 WP_002356595.1.8901 WP_002356595.1.89060 WP_002356595.1.89321 WP_002356595.1.89431 WP_002356595.1.8960 WP_002356595.1.89791 WP_002356595.1.90047 WP_002356595.1.90100 WP_002356595.1.90371 WP_002356595.1.90503 WP_002356595.1.90642 WP_002356595.1.90872 WP_002356595.1.91092 WP_002356595.1.91394 WP_002356595.1.91555 WP_002356595.1.9159 WP_002356595.1.91813 WP_002356595.1.91925 WP_002356595.1.92037 WP_002356595.1.92073 WP_002356595.1.9214 WP_002356595.1.92348 WP_002356595.1.92820 WP_002356595.1.93159 WP_002356595.1.93277 WP_002356595.1.93642 WP_002356595.1.94041 WP_002356595.1.94399 WP_002356595.1.94506 WP_002356595.1.94612 WP_002356595.1.94630 WP_002356595.1.94964 WP_002356595.1.95143 WP_002356595.1.95212 WP_002356595.1.95228 WP_002356595.1.95340 WP_002356595.1.95445 WP_002356595.1.95493 WP_002356595.1.95534 WP_002356595.1.95629 WP_002356595.1.9570 WP_002356595.1.95935 WP_002356595.1.95970 WP_002356595.1.95971 WP_002356595.1.96320 WP_002356595.1.96467 WP_002356595.1.96481 WP_002356595.1.96745 WP_002356595.1.96987 WP_002356595.1.97078 WP_002356595.1.97643 WP_002356595.1.97828 WP_002356595.1.98078 WP_002356595.1.9842 WP_002356595.1.98840 WP_002356595.1.98868 WP_002356595.1.99 WP_002356595.1.99014 WP_002356595.1.99022 WP_002356595.1.9925 WP_002356595.1.99432 WP_002356595.1.99543 WP_002356595.1.99748 gi|29377059|ref|NP_816213.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]