SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384514098|ref|YP_005709191.1| from Enterococcus faecalis OG1RF

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384514098|ref|YP_005709191.1|
Domain Number 1 Region: 26-133
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.29e-34
Family HxlR-like 0.0000694
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384514098|ref|YP_005709191.1|
Sequence length 139
Comment MarR family transcriptional regulator [Enterococcus faecalis OG1RF]
Sequence
MYHRYLLVTFVYYQPVKEECFLETRTYAIGVEATMDVIGGKWKPIILCNLRHGAMRPSDL
KRGITGISQKMLTQQLRELEEDNIIERKVYNQVPPKVEYYLSDYGQSLSAVLDNLCNWGE
SHVAHLQEQGQEIYLKCED
Download sequence
Identical sequences S4CB66
gi|384514098|ref|YP_005709191.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]