SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384514153|ref|YP_005709246.1| from Enterococcus faecalis OG1RF

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384514153|ref|YP_005709246.1|
Domain Number 1 Region: 11-144
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.93e-28
Family MarR-like transcriptional regulators 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384514153|ref|YP_005709246.1|
Sequence length 146
Comment MarR family transcriptional regulator [Enterococcus faecalis OG1RF]
Sequence
MEPNLETVNDYLVSVFNDILTIEESELKKSQFNDLSITEMHTIEAIGMYKKKTSSEVAKE
LSITVGTLTVAINNLVKKGYVERLRSEDDRRVVKLGLTKKGKLLFRVHQHFHREMVKNIL
KGMEQEEEQALLRALKNLHDFLQEYK
Download sequence
Identical sequences A0A059MWS8 A0A0E9EL26 A0A0H1U761 A0A0M2A8L4 A0A0M2AQU9 A0A0M2CJ78 A0A0U1AZ48 A0A0Y7I5U0 A0A121KKY7 A0A1B4XRK0 A0A1R4KGC5 C7VEM8 C7WZ24 D4EIW0 D4ES68 E0H985 E2YDB5 E2YK80 E2YXM9 E6F1J9 E6GJ25 E6GS52 E6H2R5 E6I8T5 R3GRL3 R3KCC9 S4BZ59 S4F8B9 S4FS07 U6S660 V7ZKX9
gi|479180946|ref|YP_007808255.1| gi|384519618|ref|YP_005706923.1| WP_002362455.1.61180 gi|397701062|ref|YP_006538850.1| gi|384514153|ref|YP_005709246.1| gi|428767976|ref|YP_007154087.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]