SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384514407|ref|YP_005709500.1| from Enterococcus faecalis OG1RF

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384514407|ref|YP_005709500.1|
Domain Number 1 Region: 5-132
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.16e-32
Family Transcriptional regulator Rrf2 0.0000595
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384514407|ref|YP_005709500.1|
Sequence length 141
Comment Rrf2 family transcriptional regulator [Enterococcus faecalis OG1RF]
Sequence
MAMSTKLSVAIHILSLIETGPQEQVTSEYIASSVNTNPVVVRRLMSQLKKAGLIHSMRGA
NKNTLLKKPEEISLYEIYTAVELEREIFNIHQNPNPNCSVGANIQSVLETEFTKVQQKME
EELKSITLADVIHEIEVKRDK
Download sequence
Identical sequences A0A059N2U7 A0A0E9EWM9 A0A0H1U552 A0A0M2A7K0 A0A0M2AP43 A0A0M2CIJ4 A0A0U1AW74 A0A111ULK0 A0A125W361 A0A1B4XS59 A0A1R4JU92 C0X115 D4EQV9 D4EZV4 E0HFX3 E2YEG9 E2YKH5 E2Z0P9 E6F0T5 E6GNE3 E6GVB5 E6H8K5 E6ID82 J5C2D5 J5H3T1 J6AI47 J6D9Y6 J6DFT7 J6DHE9 J6LTF9 J6M464 J6NDJ1 J6PAU2 J6PHN9 J6QCT1 J6QTH2 J6QW00 J6R3V3 J6RC27 Q82Z95 R3GQS3 R3HUX0 S4CA43 S4EEB5 S4F6Z3 U6RXV9 V7ZQG2 X5NUT6
gi|29377625|ref|NP_816779.1| gi|397701316|ref|YP_006539104.1| gi|428768280|ref|YP_007154391.1| gi|384516971|ref|YP_005704276.1| gi|479181670|ref|YP_007808979.1| NP_816779.1.90627 WP_002383201.1.100343 WP_002383201.1.100390 WP_002383201.1.100415 WP_002383201.1.100482 WP_002383201.1.101272 WP_002383201.1.101275 WP_002383201.1.101479 WP_002383201.1.101808 WP_002383201.1.101818 WP_002383201.1.101914 WP_002383201.1.102128 WP_002383201.1.10330 WP_002383201.1.10696 WP_002383201.1.10758 WP_002383201.1.11048 WP_002383201.1.11193 WP_002383201.1.11284 WP_002383201.1.11459 WP_002383201.1.11651 WP_002383201.1.12145 WP_002383201.1.12625 WP_002383201.1.12630 WP_002383201.1.12889 WP_002383201.1.1291 WP_002383201.1.12926 WP_002383201.1.13365 WP_002383201.1.13369 WP_002383201.1.1344 WP_002383201.1.13739 WP_002383201.1.14157 WP_002383201.1.14180 WP_002383201.1.14269 WP_002383201.1.14402 WP_002383201.1.14420 WP_002383201.1.14750 WP_002383201.1.14792 WP_002383201.1.15286 WP_002383201.1.15543 WP_002383201.1.15705 WP_002383201.1.1595 WP_002383201.1.16241 WP_002383201.1.16763 WP_002383201.1.17164 WP_002383201.1.17287 WP_002383201.1.17682 WP_002383201.1.17799 WP_002383201.1.17800 WP_002383201.1.1799 WP_002383201.1.18048 WP_002383201.1.18259 WP_002383201.1.18260 WP_002383201.1.18390 WP_002383201.1.18416 WP_002383201.1.18475 WP_002383201.1.18709 WP_002383201.1.19031 WP_002383201.1.19115 WP_002383201.1.19165 WP_002383201.1.1948 WP_002383201.1.19601 WP_002383201.1.19675 WP_002383201.1.19734 WP_002383201.1.19902 WP_002383201.1.20348 WP_002383201.1.20659 WP_002383201.1.2067 WP_002383201.1.20674 WP_002383201.1.2171 WP_002383201.1.21993 WP_002383201.1.22059 WP_002383201.1.2207 WP_002383201.1.22796 WP_002383201.1.23017 WP_002383201.1.23054 WP_002383201.1.23319 WP_002383201.1.23322 WP_002383201.1.23498 WP_002383201.1.23569 WP_002383201.1.23904 WP_002383201.1.24059 WP_002383201.1.24064 WP_002383201.1.24526 WP_002383201.1.24581 WP_002383201.1.246 WP_002383201.1.24743 WP_002383201.1.2486 WP_002383201.1.25180 WP_002383201.1.25583 WP_002383201.1.25669 WP_002383201.1.25702 WP_002383201.1.25704 WP_002383201.1.25979 WP_002383201.1.26187 WP_002383201.1.26451 WP_002383201.1.27216 WP_002383201.1.274 WP_002383201.1.2799 WP_002383201.1.2801 WP_002383201.1.28185 WP_002383201.1.28428 WP_002383201.1.28487 WP_002383201.1.28579 WP_002383201.1.28817 WP_002383201.1.28932 WP_002383201.1.28980 WP_002383201.1.29097 WP_002383201.1.29627 WP_002383201.1.29985 WP_002383201.1.3016 WP_002383201.1.30275 WP_002383201.1.30586 WP_002383201.1.30609 WP_002383201.1.31224 WP_002383201.1.31324 WP_002383201.1.31326 WP_002383201.1.31656 WP_002383201.1.31869 WP_002383201.1.32099 WP_002383201.1.321 WP_002383201.1.32265 WP_002383201.1.32385 WP_002383201.1.32914 WP_002383201.1.33139 WP_002383201.1.33306 WP_002383201.1.33460 WP_002383201.1.33513 WP_002383201.1.33531 WP_002383201.1.33574 WP_002383201.1.33581 WP_002383201.1.33685 WP_002383201.1.33798 WP_002383201.1.33851 WP_002383201.1.34192 WP_002383201.1.34256 WP_002383201.1.34766 WP_002383201.1.34947 WP_002383201.1.34999 WP_002383201.1.35171 WP_002383201.1.35283 WP_002383201.1.35810 WP_002383201.1.35823 WP_002383201.1.36198 WP_002383201.1.36209 WP_002383201.1.36269 WP_002383201.1.3645 WP_002383201.1.36880 WP_002383201.1.36900 WP_002383201.1.37031 WP_002383201.1.37181 WP_002383201.1.37810 WP_002383201.1.37850 WP_002383201.1.37996 WP_002383201.1.38725 WP_002383201.1.38784 WP_002383201.1.3909 WP_002383201.1.39119 WP_002383201.1.39771 WP_002383201.1.39932 WP_002383201.1.4014 WP_002383201.1.40357 WP_002383201.1.4071 WP_002383201.1.40757 WP_002383201.1.40908 WP_002383201.1.41053 WP_002383201.1.41792 WP_002383201.1.41867 WP_002383201.1.42239 WP_002383201.1.42353 WP_002383201.1.42483 WP_002383201.1.42904 WP_002383201.1.42908 WP_002383201.1.43540 WP_002383201.1.43903 WP_002383201.1.43994 WP_002383201.1.44185 WP_002383201.1.44242 WP_002383201.1.44501 WP_002383201.1.44537 WP_002383201.1.44626 WP_002383201.1.4487 WP_002383201.1.45269 WP_002383201.1.45484 WP_002383201.1.455 WP_002383201.1.4561 WP_002383201.1.45643 WP_002383201.1.45742 WP_002383201.1.45860 WP_002383201.1.45925 WP_002383201.1.46056 WP_002383201.1.46113 WP_002383201.1.46346 WP_002383201.1.46348 WP_002383201.1.46357 WP_002383201.1.46448 WP_002383201.1.46606 WP_002383201.1.46621 WP_002383201.1.47172 WP_002383201.1.47225 WP_002383201.1.47407 WP_002383201.1.47539 WP_002383201.1.47856 WP_002383201.1.47867 WP_002383201.1.48063 WP_002383201.1.48153 WP_002383201.1.48676 WP_002383201.1.49131 WP_002383201.1.49392 WP_002383201.1.49646 WP_002383201.1.4975 WP_002383201.1.49914 WP_002383201.1.49961 WP_002383201.1.50067 WP_002383201.1.50115 WP_002383201.1.50160 WP_002383201.1.50513 WP_002383201.1.50810 WP_002383201.1.5083 WP_002383201.1.50938 WP_002383201.1.51046 WP_002383201.1.5113 WP_002383201.1.51694 WP_002383201.1.51712 WP_002383201.1.52575 WP_002383201.1.52614 WP_002383201.1.52639 WP_002383201.1.52926 WP_002383201.1.53279 WP_002383201.1.53342 WP_002383201.1.53631 WP_002383201.1.53989 WP_002383201.1.53992 WP_002383201.1.54277 WP_002383201.1.54634 WP_002383201.1.54652 WP_002383201.1.54795 WP_002383201.1.54934 WP_002383201.1.55065 WP_002383201.1.56483 WP_002383201.1.5680 WP_002383201.1.56974 WP_002383201.1.57048 WP_002383201.1.57136 WP_002383201.1.57163 WP_002383201.1.57211 WP_002383201.1.57242 WP_002383201.1.57302 WP_002383201.1.57542 WP_002383201.1.57671 WP_002383201.1.57705 WP_002383201.1.57758 WP_002383201.1.58620 WP_002383201.1.5872 WP_002383201.1.58766 WP_002383201.1.59454 WP_002383201.1.59564 WP_002383201.1.59645 WP_002383201.1.59690 WP_002383201.1.59698 WP_002383201.1.5994 WP_002383201.1.59964 WP_002383201.1.60200 WP_002383201.1.60220 WP_002383201.1.60361 WP_002383201.1.60394 WP_002383201.1.60422 WP_002383201.1.60579 WP_002383201.1.60776 WP_002383201.1.60940 WP_002383201.1.61083 WP_002383201.1.61089 WP_002383201.1.61103 WP_002383201.1.61180 WP_002383201.1.61290 WP_002383201.1.61503 WP_002383201.1.6167 WP_002383201.1.61932 WP_002383201.1.62644 WP_002383201.1.62847 WP_002383201.1.62949 WP_002383201.1.6312 WP_002383201.1.63148 WP_002383201.1.63158 WP_002383201.1.63477 WP_002383201.1.63507 WP_002383201.1.63848 WP_002383201.1.63884 WP_002383201.1.64022 WP_002383201.1.64483 WP_002383201.1.6473 WP_002383201.1.65210 WP_002383201.1.65397 WP_002383201.1.65563 WP_002383201.1.6626 WP_002383201.1.66308 WP_002383201.1.66316 WP_002383201.1.66390 WP_002383201.1.66403 WP_002383201.1.66767 WP_002383201.1.6682 WP_002383201.1.66843 WP_002383201.1.66845 WP_002383201.1.66898 WP_002383201.1.66902 WP_002383201.1.67615 WP_002383201.1.67683 WP_002383201.1.67716 WP_002383201.1.68746 WP_002383201.1.68828 WP_002383201.1.6893 WP_002383201.1.68935 WP_002383201.1.69290 WP_002383201.1.69336 WP_002383201.1.69648 WP_002383201.1.69824 WP_002383201.1.70043 WP_002383201.1.70675 WP_002383201.1.70756 WP_002383201.1.70799 WP_002383201.1.7118 WP_002383201.1.71303 WP_002383201.1.71406 WP_002383201.1.71499 WP_002383201.1.71510 WP_002383201.1.72077 WP_002383201.1.72635 WP_002383201.1.72733 WP_002383201.1.73695 WP_002383201.1.73817 WP_002383201.1.73824 WP_002383201.1.74389 WP_002383201.1.74591 WP_002383201.1.75211 WP_002383201.1.75297 WP_002383201.1.75486 WP_002383201.1.75949 WP_002383201.1.76074 WP_002383201.1.76128 WP_002383201.1.76541 WP_002383201.1.76646 WP_002383201.1.76958 WP_002383201.1.77302 WP_002383201.1.77327 WP_002383201.1.77328 WP_002383201.1.77357 WP_002383201.1.77956 WP_002383201.1.7815 WP_002383201.1.7819 WP_002383201.1.78447 WP_002383201.1.78471 WP_002383201.1.78503 WP_002383201.1.78587 WP_002383201.1.78641 WP_002383201.1.79457 WP_002383201.1.7958 WP_002383201.1.79791 WP_002383201.1.79975 WP_002383201.1.80104 WP_002383201.1.80396 WP_002383201.1.80452 WP_002383201.1.80556 WP_002383201.1.8058 WP_002383201.1.80889 WP_002383201.1.80976 WP_002383201.1.81312 WP_002383201.1.81327 WP_002383201.1.81459 WP_002383201.1.81575 WP_002383201.1.8179 WP_002383201.1.81880 WP_002383201.1.81991 WP_002383201.1.82160 WP_002383201.1.82202 WP_002383201.1.82555 WP_002383201.1.82993 WP_002383201.1.83032 WP_002383201.1.83327 WP_002383201.1.83490 WP_002383201.1.83649 WP_002383201.1.8380 WP_002383201.1.83953 WP_002383201.1.84260 WP_002383201.1.84380 WP_002383201.1.84469 WP_002383201.1.84573 WP_002383201.1.84632 WP_002383201.1.84813 WP_002383201.1.85162 WP_002383201.1.85355 WP_002383201.1.85465 WP_002383201.1.85534 WP_002383201.1.8575 WP_002383201.1.85848 WP_002383201.1.85862 WP_002383201.1.85945 WP_002383201.1.85963 WP_002383201.1.86134 WP_002383201.1.86904 WP_002383201.1.87000 WP_002383201.1.87252 WP_002383201.1.87277 WP_002383201.1.87385 WP_002383201.1.87482 WP_002383201.1.87855 WP_002383201.1.8794 WP_002383201.1.88329 WP_002383201.1.88464 WP_002383201.1.8901 WP_002383201.1.89088 WP_002383201.1.89321 WP_002383201.1.89431 WP_002383201.1.8960 WP_002383201.1.89791 WP_002383201.1.90047 WP_002383201.1.90100 WP_002383201.1.90371 WP_002383201.1.90503 WP_002383201.1.90642 WP_002383201.1.90872 WP_002383201.1.91092 WP_002383201.1.91394 WP_002383201.1.91555 WP_002383201.1.9159 WP_002383201.1.91608 WP_002383201.1.91813 WP_002383201.1.91925 WP_002383201.1.92037 WP_002383201.1.92073 WP_002383201.1.9214 WP_002383201.1.92348 WP_002383201.1.92581 WP_002383201.1.93159 WP_002383201.1.93277 WP_002383201.1.93642 WP_002383201.1.93977 WP_002383201.1.94041 WP_002383201.1.94399 WP_002383201.1.94506 WP_002383201.1.94612 WP_002383201.1.94630 WP_002383201.1.94964 WP_002383201.1.95143 WP_002383201.1.95212 WP_002383201.1.95228 WP_002383201.1.95340 WP_002383201.1.95445 WP_002383201.1.95493 WP_002383201.1.95534 WP_002383201.1.9570 WP_002383201.1.95935 WP_002383201.1.95970 WP_002383201.1.95971 WP_002383201.1.96320 WP_002383201.1.96481 WP_002383201.1.96745 WP_002383201.1.96764 WP_002383201.1.96987 WP_002383201.1.97078 WP_002383201.1.97268 WP_002383201.1.97643 WP_002383201.1.97828 WP_002383201.1.98078 WP_002383201.1.98122 WP_002383201.1.9842 WP_002383201.1.98652 WP_002383201.1.98840 WP_002383201.1.98868 WP_002383201.1.99 WP_002383201.1.99022 WP_002383201.1.9925 WP_002383201.1.99432 WP_002383201.1.99543 gi|384514407|ref|YP_005709500.1| APC29642 226185.EF3175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]