SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383327495|ref|YP_005353379.1| from Enterococcus faecium Aus0004

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383327495|ref|YP_005353379.1|
Domain Number 1 Region: 5-115
Classification Level Classification E-value
Superfamily YheA/YmcA-like 9.68e-22
Family YmcA-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383327495|ref|YP_005353379.1|
Sequence length 124
Comment hypothetical protein EFAU004_00175 [Enterococcus faecium Aus0004]
Sequence
MQQEPEIQKEVRKLTKLLRENETIIRYKELEEKIQQNQYLAELREKIKQAQKDAVHFAHY
DKPAAEKEAIKQADQFMQEFDQHPLVVAYRKQLLEADDLLHHLTTMIQEEINGQIEEEKH
ASKN
Download sequence
Identical sequences A0A132Z866 T4JYW5
gi|383327495|ref|YP_005353379.1| gi|529232847|ref|YP_008393659.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]