SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340505592|gb|EGR31909.1| from Ichthyophthirius multifiliis strain G5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340505592|gb|EGR31909.1|
Domain Number 1 Region: 296-472
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 9.81e-37
Family cAMP-binding domain 0.008
Further Details:      
 
Domain Number 2 Region: 160-334
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.36e-22
Family Voltage-gated potassium channels 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|340505592|gb|EGR31909.1|
Sequence length 559
Comment hypothetical protein IMG5_100600 [Ichthyophthirius multifiliis]
Sequence
MYLNLQEELEAQVPHQDFEKWEYNNLKLQMINHRIIHIILLKNTLQLMQIFIFLNIYFFF
YIKQNKKLFGLFLISLLLLLILYLFLSNILLQYKIQVFQLFQFKNFLFLLLELKYFLLFL
QQIFMNYIKERFLFDLIIFILFCIGNRNNLYTDLFILLKVQDIFNILREIDERFQFKGKI
QNIYELSKIIIFILIFAHFLACCWHQAGVYSFNQGEQETWLGKTYQDHYNENNNKQIYIQ
SMYWAVVSMITLGYGDIIPKNQIEMVFVIFATLLSCIIFAYAMNSIGEILKQMGRKKLIL
KQQMGIINTYMRKRCLNQEIQVKVRKYFEYLNKEQMEDNEQSSQLILNMPQSLKEEVFQD
VYGQILKSKKMLNLHFSNQFLMELSMQMKEKRYGPEEILLKQNNVSKNLYFIMKGKGDLF
NEINFFTEKISEFTAITGNVTSLAILEKCSFLQIIKKFPKDYEQYCYMRDNIKLYENIQG
MDHQCVGCSSYSHTLESCQYVNFVRNRQKILAYYTKNNYFFRIGIILKEKDKLNHGILGK
NLIIHLLLKNKLNKKNNKQ
Download sequence
Identical sequences G0QSB1
gi|340505592|gb|EGR31909.1| XP_004035395.1.64148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]