SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340509212|gb|EGR34768.1| from Ichthyophthirius multifiliis strain G5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340509212|gb|EGR34768.1|
Domain Number 1 Region: 207-364
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.75e-22
Family Voltage-gated potassium channels 0.0041
Further Details:      
 
Domain Number 2 Region: 324-459
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 7.6e-22
Family cAMP-binding domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|340509212|gb|EGR34768.1|
Sequence length 560
Comment hypothetical protein IMG5_002400 [Ichthyophthirius multifiliis]
Sequence
MIQSINSHMYKNLTAMQVYIIGDKLFEQTYNFNLTNNIRKKKYHFQNYVIMRFYKKFYKF
LKKIDKKIKILEPQNKLVTIINFLNLLSLIQLFFIFTIKVSLQTTKFISSYNIQIYISIF
FVILNSLMNLNTGFYQKGIVCKERYQILQYYKSQYLFKDLLFLLSVVFLSMESQNAQLKN
INNWFQLILIFILLIKLQDFNQIINKFEQIFLLKQKTQNIISLMKLFSFIIFFLHLICCL
WLYVSFLNPNMNWLSKLQIQDQEWHVKYIYSFYFSTTTLTTVGFGDIQPSNIQEATCCVF
IMLFCCGTYGFILNQVGSILQEFNQDEKQMKLKFDNINQYMSKKNISNSLKNEIREYLEY
VWTESNQEMIIQSKEILNQLNENLYNNFQYEQNKTLIKYFEKYFSKDFTEQINSIIQEKQ
TNPKEIIYENGQIDDQSIYFIEKGYVEIYLKNEKKILKVIFFFFFFDLKKQRLSVKIIYL
VNNNFLMEKKEILMQELKILYIVQKSKEMTFQSYFKIIQKIMRNFYIQKIKQFQIKKQKF
QNQNALAVKVIVMYIKTVII
Download sequence
Identical sequences G0QJ44
XP_004040072.1.64148 gi|340509212|gb|EGR34768.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]