SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386836268|ref|YP_006241326.1| from Streptomyces hygroscopicus subsp. jinggangensis 5008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386836268|ref|YP_006241326.1|
Domain Number 1 Region: 842-903
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 7.48e-16
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0043
Further Details:      
 
Domain Number 2 Region: 3-65,98-219
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000193
Family Nitrogenase iron protein-like 0.054
Further Details:      
 
Weak hits

Sequence:  gi|386836268|ref|YP_006241326.1|
Domain Number - Region: 593-733
Classification Level Classification E-value
Superfamily TPR-like 0.00402
Family Tetratricopeptide repeat (TPR) 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386836268|ref|YP_006241326.1|
Sequence length 919
Comment LuxR family transcriptional regulator [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence
MELIGRDSDVGSIRDFFETAGVRGGALLMVGEAGVGKTAVLDEIASMEAKNGARVLRAAG
VQFEADVNYSVLNQLLFSLDDDMASLPDAHRTALRCALGFEVGSLPDRLVVSNAAVLWLR
SVAADTPLLILVDDLHWVDRASAEVLSFVARRLVGSPIVFLGACRTAERGFFANGGLTEM
TLPPLPAAAARTLVDRSFPGLGPTVRQRLLNEAAGNPLALLELPSALDGDQHSNFTALPA
VLPLTDRLRVMFASRVGGLPERCRLMMLLGALGGTTELTRLSTAGGSMCDLDDLKPAEEG
RLVQVSASRLSFRHPLVGAAVVEACSERDRRWAHGALAEVIDTPERRVRHLAESATGPDE
DIAGQLEATAQVLLRQGDAIGAVAAMTRAAELSPDLADRGRRLAEAAYVGAEAGGEMVTA
TRLLGDARRSGKLDAHSLPAAAAAAHLLINAEGDVTTAFRLLAGAIHAGDHGYDAENPVL
IEAMYSLQLISWWVGTEEAGRTARTLVDRLVPQPPPLLRVYAGVFPDPARATSEDIATLD
ELIDFVAADEDPTRLVRIGTAALFADRLSRLRRPEQYLAQMGREGKGPARRHLGALIHLA
LDAFLAGRWEQAWELSDEGIAVSSEHGFKFFRWYFDWVHALVAAARGEAEAARQLTDDMV
RWAVAHQATGVTYFALQARAFNEIAAGDYDGAYQSATRVSPAGQFAPYRPTALWAGLDLV
EAALHTGRRDEAVAHAAAMREARLDKLSPRLRLLTAGAAALTADDDCARDRFEAALAVPD
AELWPLELARVRLAYGERLRRLRDTGAARQQLTIAHDVLAGLKAVPWRDRAANELRATGM
SRRSTTDATAALTPQEREIAELASAGLTNKQIGQKLFISHRTVGDHLYKIFPKLGITSRA
ALRDALNAYDQQGPGTPVM
Download sequence
Identical sequences H2K6C9
gi|386836268|ref|YP_006241326.1| WP_014668808.1.21199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]