SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386836447|ref|YP_006241505.1| from Streptomyces hygroscopicus subsp. jinggangensis 5008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386836447|ref|YP_006241505.1|
Domain Number 1 Region: 2-187
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 1.88e-20
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386836447|ref|YP_006241505.1|
Sequence length 202
Comment formate dehydrogenase [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence
MVHRATGYLMLVCLVTAACLYLGPLAQLVGRRHLMVTLHEWSGISLPLPFLLGLLSADFR
ADLRRLNRFAVYDRQWLRAVRKRRTAPEARPAGKFNAGQKIYAGWIAGAVLVMMSTGLLM
WFMGLLPSISRTSAIFVHDLLAWAITFVLIGHMRRAFEDPEARLGMRTGYVSRSWAERYH
SRWLKEEGMGTVTGETEEADKV
Download sequence
Identical sequences H2JJS1
gi|474978723|ref|YP_007689189.1| gi|386836447|ref|YP_006241505.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]