SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386836498|ref|YP_006241556.1| from Streptomyces hygroscopicus subsp. jinggangensis 5008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386836498|ref|YP_006241556.1|
Domain Number 1 Region: 204-488
Classification Level Classification E-value
Superfamily Subtilisin-like 6.02e-80
Family Subtilases 0.00000325
Further Details:      
 
Domain Number 2 Region: 777-880
Classification Level Classification E-value
Superfamily PA domain 0.0000131
Family PA domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386836498|ref|YP_006241556.1|
Sequence length 1220
Comment secreted peptidase [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence
MFAVLAASPVPAFPASEPPAPPPAASTTPAAVPPDAPRVTLVTGDTVTVVRAPDGTLSHL
VQDPEGRYTGFETHRSGRDTYVYPRDALPYVADGSLDRELFDVTRLLADGYDDAHRDRLP
LIVTYTDAGRHSGRQTPPRGARTTRTLESIGGAALAVDRSAAFWTSVTGGAAARDANQRP
RLRGGIAKIWLDGKVKAALAESTAQVGAPRVWASGDTGEGVDVAVLDTGVDAGHPDLAGR
IAATAGFVPGESVTDANGHGTHVASTIAGTGAASGGREKGVAPGARLHIGKVLSDDGTGQ
DSWVLAGMEWAARDQHAKVISMSLGGPSTDGSDPLSMAVDRLSEETGALFTVAAGNSGPD
GYTVGAPGVADAALTVGAVDGSDTLADFSSRGPRPGDRGVKPDLTAPGVDILAARSQYAP
EGSGPYQTLSGTSMATPHVAGAAALLAARHPGFSGRQLKDALVSTTAATPRYTPFEAGAG
RLDIAATATATVFASGGADFGFHAWPTPAGTTAERTVTYTNTAGSPIALRLTTGGPFSLS
ADRLSVPAHGTAAVTVTAHYDQVPADRASAAFLTATDDSGTVRARTSLSAAKEGERHRLT
LKAKDRAGRPAAGTVILTAKKFWLPLALDNSGTTDLRLPPGSYTAWLDTPLEGAHGPHSI
GQGLLAVTDIDLGRDRTAVFDGTKARQVRTVAPDPSTPDGSRVDLYRGFAADDWSSSSRW
TDAAYDSVWALPTGREVAEGEFVFGTRWRLRQPTLTVASGDGAFDDLRVAPGATPLPEGR
RRLDAVFAGDGAPAAYNSLDVRGKAAVVRRDDTVPVPEQAAAATAAGARLLLVVNDGDGR
LQAWDDSPWLPADPPPLTVATLTRDEGERLITRTSGHARTRLSVTSHPVTEYVYDLVHDY
RGAVPADPVHRADRRELARVDVSFRNYRAGRALENRDDVTPVGGSALNPSDAPALGERTD
WVTAGEPWSDRAQIPGEQQQYAPAVTYRAGSADRVSWFGPVQRPRLLDGDAPVRQDDRLY
VSVPGWGDSGTGHLGGTYGNFDVDNRVRLYQGDELVREMGRYQLTMTVSGLSPAPLPYRL
VSENSRDAWAAPYSTATRTEWGFTSRAGAAGEQAQLPLIQLDYGIATDASGRAGRHAGLT
VTASHLPGSTGTAAIGQVGLEISYDDGVTWRGTALRHSDTGWRTRLDAPRAARFVSLRVD
ARDARGNSVRQSIVRAFGLG
Download sequence
Identical sequences H2JL56
WP_014669031.1.21199 WP_014669031.1.57224 gi|386836498|ref|YP_006241556.1| gi|474978774|ref|YP_007689240.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]