SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386836662|ref|YP_006241720.1| from Streptomyces hygroscopicus subsp. jinggangensis 5008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386836662|ref|YP_006241720.1|
Domain Number 1 Region: 266-382
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000258
Family Tetratricopeptide repeat (TPR) 0.037
Further Details:      
 
Domain Number 2 Region: 30-179
Classification Level Classification E-value
Superfamily TPR-like 0.00000278
Family Tetratricopeptide repeat (TPR) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386836662|ref|YP_006241720.1|
Sequence length 399
Comment hypothetical protein SHJG_0570 [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence
MLAQLAERLGCDPGYLTGLITAPGTDDVEIQLHSAQLTLRNGDARAALDGFTALRSQVAD
SDRADLRFAVELGIAQCLEEQGDLEEAARAFESLLHRSAAEGRGVLSRLSAATPLCRCYR
ELGDLSRAVDVAEEILAEADALDLPPTVGQLELLSTLIGVYSERGDLHRANFLADEAMSR
AQLMADRKALGSAYWKASVDLNRRGRSGDALVLVKKAVALYTEGDDERALARLRNAQATV
LLQSEECDPEVAKGLLQQSAAALRALGSKLDLADVETALARAEVLLGRPEKAMEHAETAL
GLLGPEHRLENARVHLVVAAVCLVQGDQEGVRAAYERTAALLEGVEAGRQAAFAWSELGE
ILEKSGENERAAWAFRQGMRLMGHRGSLVADVPRRVRAD
Download sequence
Identical sequences H2JPC4
gi|386836662|ref|YP_006241720.1| gi|474978937|ref|YP_007689403.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]